NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS6284.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6284.1 Public Homo sapiens 8 COX6C 24 110 108 CCDS HistoryNCBI Gene:1345Re-query CCDS DB by CCDS ID:6284.1Re-query CCDS DB by GeneID:1345See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6284.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000297564.6 ENSP00000297564.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000297564.6Link to Ensembl Protein Viewer:ENSP00000297564.2Re-query CCDS DB by Nucleotide ID:ENST00000297564Re-query CCDS DB by Protein ID:ENSP00000297564
Original member Current member EBI ENST00000520271.5 ENSP00000428150.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000520271.5Link to Ensembl Protein Viewer:ENSP00000428150.1Re-query CCDS DB by Nucleotide ID:ENST00000520271Re-query CCDS DB by Protein ID:ENSP00000428150
Original member Current member EBI ENST00000522934.5 ENSP00000428702.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000522934.5Link to Ensembl Protein Viewer:ENSP00000428702.1Re-query CCDS DB by Nucleotide ID:ENST00000522934Re-query CCDS DB by Protein ID:ENSP00000428702
Original member Current member EBI ENST00000520468.7 ENSP00000428895.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000520468.7Link to Ensembl Protein Viewer:ENSP00000428895.1Re-query CCDS DB by Nucleotide ID:ENST00000520468Re-query CCDS DB by Protein ID:ENSP00000428895
Original member Current member EBI ENST00000522940.5 ENSP00000428965.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000522940.5Link to Ensembl Protein Viewer:ENSP00000428965.1Re-query CCDS DB by Nucleotide ID:ENST00000522940Re-query CCDS DB by Protein ID:ENSP00000428965
Original member Current member EBI ENST00000524245.5 ENSP00000429410.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000524245.5Link to Ensembl Protein Viewer:ENSP00000429410.1Re-query CCDS DB by Nucleotide ID:ENST00000524245Re-query CCDS DB by Protein ID:ENSP00000429410
Original member Current member EBI ENST00000523016.1 ENSP00000429707.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000523016.1Link to Ensembl Protein Viewer:ENSP00000429707.1Re-query CCDS DB by Nucleotide ID:ENST00000523016Re-query CCDS DB by Protein ID:ENSP00000429707
Original member Current member EBI ENST00000517682.6 ENSP00000429714.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000517682.6Link to Ensembl Protein Viewer:ENSP00000429714.1Re-query CCDS DB by Nucleotide ID:ENST00000517682Re-query CCDS DB by Protein ID:ENSP00000429714
Original member Current member EBI ENST00000518171.5 ENSP00000429755.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000518171.5Link to Ensembl Protein Viewer:ENSP00000429755.1Re-query CCDS DB by Nucleotide ID:ENST00000518171Re-query CCDS DB by Protein ID:ENSP00000429755
Original member Current member EBI ENST00000520517.5 ENSP00000429991.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000520517.5Link to Ensembl Protein Viewer:ENSP00000429991.1Re-query CCDS DB by Nucleotide ID:ENST00000520517Re-query CCDS DB by Protein ID:ENSP00000429991
Original member Current member NCBI NM_004374.4 NP_004365.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_004374.4Link to Protein Sequence:NP_004365.1Re-query CCDS DB by Nucleotide ID:NM_004374Re-query CCDS DB by Protein ID:NP_004365Link to BLAST:NP_004365.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_004365.1 75 P09669 75 100% 0 0

Chromosomal Locations for CCDS 6284.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 99887505 99887618 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 99891908 99892021 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (228 nt):
ATGGCTCCCGAAGTTTTGCCAAAACCTCGGATGCGTGGCCTTCTGGCCAGGCGTCTGCGAAATCATATGG
CT
GTAGCATTCGTGCTATCCCTGGGGGTTGCAGCTTTGTATAAGTTTCGTGTGGCTGATCAAAGAAAGAA
G
GCATACGCAGATTTCTACAGAAACTACGATGTCATGAAAGATTTTGAGGAGATGAGGAAGGCTGGTATC
TTT
CAGAGTGTAAAGTAA


Translation (75 aa):
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGI
F
QSVK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser