Identification
- Summary
Chorionic Gonadotropin (Human) is a naturally-occurring hormone produced during human placenta used for the treatment of prepubertal cryptorchidism and hypogonadotropic hypogonadism in selected males, and induction of pregnancy in selected infertile women.
- Brand Names
- Novarel, Pregnyl
- Generic Name
- Chorionic Gonadotropin (Human)
- DrugBank Accession Number
- DB09126
- Background
Human chorionic gonadotropin (HCG), a polypeptide hormone produced by the human placenta. Endogenously produced HCG interacts with the LHCG receptor of the ovary and promotes the maintenance of the corpus luteum during the beginning of pregnancy. This allows the corpus luteum to continuously secrete the hormone progesterone during the first trimester, which is required for maintenance of the uterus and prevents menstruation. In males, HCG also stimulates the production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens.
HCG is composed of an alpha and a beta sub-unit. The alpha sub-unit is essentially identical to the alpha sub units of the human pituitary gonadotropins, luteinizing hormone (LH) and follicle-stimulating hormone (FSH), as well as to the alpha sub-unit of human thyroid-stimulating hormone (TSH), while the beta sub units of these hormones differ in amino acid sequence. As a drug product, chorionic gonadotropin is a highly purified pyrogen-free preparation obtained from the urine of pregnant females.
- Type
- Biotech
- Groups
- Approved, Vet approved
- Biologic Classification
- Protein Based Therapies
Hormones - Protein Structure
- Protein Chemical Formula
- Not Available
- Protein Average Weight
- Not Available
- Sequences
>Alpha Chain APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>Beta Chain SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS SKAPPPSLPSPSRLPGPSDTPILPQ
Download FASTA Format- Synonyms
- Chorionic gonadotrophin
- Chorionic gonadotropin
- Gonadotropin, Chorionic
- Gonadotropin,chorionic
- h-HCG
- hCG
- Human chorionic gonadotropin
- Human menopausal gonadotropin
- Human menopausal gonadotropin (urine derived)
- Human-chorionic gonadotropin
- Urinary hCG
Pharmacology
- Indication
For the treatment of prepubertal cryptorchidism (not due to anatomical obstruction), for the treatment of selected cases of hypogonadotropic hypogonadism (hypogonadism secondary to a pituitary deficiency) in males and for the induction of ovulation and pregnancy in the anovulatory, infertile woman in whom the cause of anovulation is secondary and not due to primary ovarian failure, and who has been appropriately pretreated with human menotropins.
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Associated Conditions
Indication Type Indication Combined Product Details Approval Level Age Group Patient Characteristics Dose Form Treatment of Cryptorchidism •••••••••••• ••••••••••• Treatment of Hypogonadotropic hypogonadism •••••••••••• Management of Secondary hypogonadotrophic hypogonadism •••••••••••• - Associated Therapies
- Contraindications & Blackbox Warnings
Prevent Adverse Drug Events TodayTap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events with our Clinical API- Pharmacodynamics
The action of HCG is virtually identical to that of pituitary LH, although HCG appears to have a small degree of FSH activity as well. It stimulates production of gonadal steroid hormones by stimulating the interstitial cells (Leydig cells) of the testis to produce androgens and the corpus luteum of the ovary to produce progesterone.
- Mechanism of action
Target Actions Organism ALutropin-choriogonadotropic hormone receptor ligandHumans - Absorption
Not Available
- Volume of distribution
Not Available
- Protein binding
Not Available
- Metabolism
- Not Available
- Route of elimination
Not Available
- Half-life
Not Available
- Clearance
Not Available
- Adverse Effects
Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!Improve decision support & research outcomes with our structured adverse effects data.- Toxicity
Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.Not Available
- Food Interactions
- No interactions found.
Products
Drug product information from 10+ global regionsOur datasets provide approved product information including:dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions.- Brand Name Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Region Image Apl Inj 1000 Iu/ml Liquid 1000 unit / mL Intramuscular Ayerst Laboratories 1951-12-31 2000-08-02 Canada 
Chorionic Gonadotropin for Injection, USP Powder, for solution 10000 unit / vial Intramuscular; Subcutaneous Fresenius Kabi 2004-09-13 Not applicable Canada Novarel Injection, powder, lyophilized, for solution; Kit 5000 [USP'U]/1 Intramuscular Ferring Pharmaceuticals Inc. 2017-08-30 Not applicable US 
Novarel Injection, powder, lyophilized, for solution; Kit 10000 [USP'U]/1 Intramuscular Ferring Pharmaceuticals Inc. 1974-01-15 Not applicable US Pregnyl Kit; Powder, for solution 10000 unit / vial Intramuscular Organon Canada Inc. 1997-08-13 Not applicable Canada - Mixture Products
Name Ingredients Dosage Route Labeller Marketing Start Marketing End Region Image A.P.L. - Pws-liq Chorionic Gonadotropin (Human) (10000 unit / kit) + Water (10 mL / kit) Liquid; Powder, for solution Intramuscular Wyeth Ayerst Canada Inc. 1998-11-11 2001-06-01 Canada Profasi Hp 10000 Chorionic Gonadotropin (Human) (10000 unit / vial) + Water (10 mL / vial) Kit; Liquid; Powder, for solution Intramuscular; Subcutaneous Emd Serono, A Division Of Emd Inc., Canada 1991-12-31 2007-05-07 Canada
Categories
- ATC Codes
- G03GA01 — Chorionic gonadotrophin
- Drug Categories
- Amino Acids, Peptides, and Proteins
- Biological Products
- Chorionic Gonadotropin
- Complex Mixtures
- Fertility Agents
- Fertility Agents, Female
- Genito Urinary System and Sex Hormones
- Gonadotropins
- Gonadotropins and Antigonadotropins
- Gonadotropins, Pituitary
- Hormones
- Hormones, Hormone Substitutes, and Hormone Antagonists
- Peptide Hormones
- Peptides
- Pituitary Hormones
- Pituitary Hormones, Anterior
- Placental Hormones
- Pregnancy Proteins
- Proteins
- Reproductive Control Agents
- Sex Hormones and Modulators of the Genital System
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Not Available
Chemical Identifiers
- UNII
- 20ED16GHEB
- CAS number
- 9002-61-3
References
- General References
- Not Available
- External Links
- KEGG Drug
- D06457
- PubChem Substance
- 347910414
- 340705
- ChEBI
- 81570
- ChEMBL
- CHEMBL1201509
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Human_chorionic_gonadotropin
- FDA label
- Download (26.7 KB)
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 4 Active Not Recruiting Treatment Female Infertility / Ovarian Hyper Stimulation Syndrome (OHSS) 1 4 Completed Basic Science Controlled Ovarian Stimulation / Infertility 1 4 Completed Basic Science Infertility / Subfertility 1 4 Completed Health Services Research Female Infertility 1 4 Completed Treatment Assisted Reproduction 1
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage Forms
Form Route Strength Liquid; powder, for solution Intramuscular Liquid Intramuscular 1000 unit / mL Powder Parenteral 1500 IU/1 Powder Parenteral 5000 IU/1 Solution Parenteral 1500 UI Injection, powder, for solution Parenteral 5000 IU Injection, solution Intramuscular 5000 iu Solution Parenteral 2000 UI Injection Parenteral 2000 iu Powder, for solution Intramuscular; Subcutaneous 10000 unit / vial Injection, powder, for solution Injection, powder, lyophilized, for solution Parenteral 5000 IU Powder Not applicable 1 g/1g Injection, powder, lyophilized, for solution Intramuscular; Subcutaneous 75 IU Injection, powder, lyophilized, for solution; kit Intramuscular 10000 [USP'U]/1 Injection, powder, lyophilized, for solution; kit Intramuscular 5000 [USP'U]/1 Injection Parenteral Injection, powder, for solution Intramuscular Kit; powder, for solution Intramuscular 10000 unit / vial Injection, powder, lyophilized, for solution Intramuscular; Subcutaneous 1500 iu Injection, powder, for solution Intramuscular 5000 IU Injection, powder, for solution Intramuscular; Subcutaneous 5000 iu Powder Parenteral 5000 IE Injection, powder, for solution 5000 IU Injection, powder, lyophilized, for solution Intramuscular; Subcutaneous 5000 IU Injection, powder, for solution Subcutaneous Kit; liquid; powder, for solution Intramuscular; Subcutaneous Powder, for solution Intramuscular 10000 unit / vial Injection, powder, lyophilized, for solution Intramuscular; Subcutaneous 1000 IU Injection Parenteral 10000 IU Injection Parenteral 5000 IU Powder Parenteral 5000 iu/1ampoule Powder Parenteral 10000 iu/1vial Powder Parenteral 2000 iu/1vial Powder Parenteral 5000 iu/1vial - Prices
- Not Available
- Patents
Patent Number Pediatric Extension Approved Expires (estimated) Region US6706681 No 2004-03-16 2021-03-16 US
Properties
- State
- Solid
- Experimental Properties
- Not Available
Targets
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Ligand
- General Function
- Luteinizing hormone receptor activity
- Specific Function
- Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
- Gene Name
- LHCGR
- Uniprot ID
- P22888
- Uniprot Name
- Lutropin-choriogonadotropic hormone receptor
- Molecular Weight
- 78642.01 Da
Drug created at September 23, 2015 16:50 / Updated at April 19, 2024 20:55