Symbol:
Stx16
Name:
syntaxin 16
RGD ID:
1309423
Description:
Predicted to enable SNAP receptor activity and syntaxin binding activity. Predicted to be involved in several processes, including endosomal transport; vesicle docking; and vesicle fusion. Is active in synaptic vesicle membrane. Human ortholog(s) of this gene implicated in pseudohypoparathyroidism type 1B. Orthologous to human STX16 (syntaxin 16); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC362283; similar to Syntaxin-16 (Syn16); syntaxin-16
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
STX16 (syntaxin 16) HGNC
Ensembl, HomoloGene, NCBI, OrthoDB, Panther
Mus musculus (house mouse):
Stx16 (syntaxin 16) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Stx16 (syntaxin 16) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NPEPL1 (aminopeptidase like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
STX16 (syntaxin 16) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
STX16 (syntaxin 16) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
STX16 (syntaxin 16) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Stx16 (syntaxin 16) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CEP76 (centrosomal protein 76) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
STX16 (syntaxin 16)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Stx16 (syntaxin 16)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
stx16 (syntaxin 16)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Syx16
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
TLG2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
syx-16
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
stx16
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 183,271,417 - 183,300,746 (+) NCBI GRCr8 mRatBN7.2 3 162,853,764 - 162,882,489 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 162,853,782 - 162,882,489 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 166,652,863 - 166,681,542 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 175,151,075 - 175,179,478 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 172,893,705 - 172,922,383 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 172,154,739 - 172,183,699 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 172,154,754 - 172,183,732 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 178,206,507 - 178,235,429 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 164,995,189 - 165,022,884 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 164,901,023 - 164,937,604 (+) NCBI Celera 3 162,030,293 - 162,057,164 (+) NCBI Celera Cytogenetic Map 3 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Stx16 Rat 1,2-dimethylhydrazine decreases expression ISO Stx16 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of STX16 mRNA CTD PMID:22206623 Stx16 Rat 17alpha-ethynylestradiol increases expression ISO Stx16 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of STX16 mRNA CTD PMID:17942748 Stx16 Rat 17alpha-ethynylestradiol multiple interactions ISO Stx16 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of STX16 mRNA CTD PMID:17942748 Stx16 Rat 17beta-estradiol decreases expression ISO Stx16 (Mus musculus) 6480464 Estradiol results in decreased expression of STX16 mRNA CTD PMID:19484750 Stx16 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of STX16 mRNA CTD PMID:35192832 Stx16 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Stx16 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of STX16 mRNA CTD PMID:17942748 Stx16 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of STX16 mRNA CTD PMID:33387578 Stx16 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO STX16 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of STX16 mRNA CTD PMID:22574217 Stx16 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Stx16 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of STX16 mRNA CTD PMID:21570461 Stx16 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Stx16 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of STX16 mRNA CTD PMID:20188158 Stx16 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of STX16 protein CTD PMID:34915118 Stx16 Rat 4,4'-sulfonyldiphenol decreases expression ISO Stx16 (Mus musculus) 6480464 bisphenol S results in decreased expression of STX16 mRNA CTD PMID:39298647 Stx16 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of STX16 mRNA CTD PMID:36041667 Stx16 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Stx16 (Mus musculus) 6480464 bisphenol S results in decreased methylation of STX16 exon CTD PMID:33297965 Stx16 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of STX16 mRNA CTD PMID:30047161 Stx16 Rat acrolein multiple interactions ISO STX16 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of STX16 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of STX16 mRNA CTD PMID:32699268 Stx16 Rat all-trans-retinoic acid decreases expression ISO STX16 (Homo sapiens) 6480464 Tretinoin results in decreased expression of STX16 mRNA CTD PMID:15498508 Stx16 Rat all-trans-retinoic acid increases expression ISO STX16 (Homo sapiens) 6480464 Tretinoin results in increased expression of STX16 mRNA CTD PMID:33167477 Stx16 Rat alpha-pinene multiple interactions ISO STX16 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of STX16 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of STX16 mRNA CTD PMID:32699268 Stx16 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of STX16 mRNA CTD PMID:30779732 Stx16 Rat arsane multiple interactions ISO STX16 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of STX16 mRNA CTD PMID:39836092 Stx16 Rat arsenic atom multiple interactions ISO STX16 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of STX16 mRNA CTD PMID:39836092 Stx16 Rat atrazine increases expression ISO STX16 (Homo sapiens) 6480464 Atrazine results in increased expression of STX16 mRNA CTD PMID:22378314 Stx16 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of STX16 mRNA CTD PMID:25181051 Stx16 Rat bisphenol A decreases expression ISO Stx16 (Mus musculus) 6480464 bisphenol A results in decreased expression of STX16 mRNA CTD PMID:32156529 Stx16 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of STX16 mRNA CTD PMID:35192832 Stx16 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of STX16 mRNA CTD PMID:36041667 Stx16 Rat bisphenol A increases expression ISO Stx16 (Mus musculus) 6480464 bisphenol A results in increased expression of STX16 mRNA CTD PMID:33221593 Stx16 Rat bisphenol AF increases expression ISO STX16 (Homo sapiens) 6480464 bisphenol AF results in increased expression of STX16 protein CTD PMID:34186270 Stx16 Rat Bisphenol B increases expression ISO STX16 (Homo sapiens) 6480464 bisphenol B results in increased expression of STX16 protein CTD PMID:34186270 Stx16 Rat bisphenol F decreases expression ISO Stx16 (Mus musculus) 6480464 bisphenol F results in decreased expression of STX16 mRNA CTD PMID:38685157 Stx16 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of STX16 mRNA CTD PMID:36041667 Stx16 Rat caffeine decreases phosphorylation ISO STX16 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of STX16 protein CTD PMID:35688186 Stx16 Rat CGP 52608 multiple interactions ISO STX16 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to STX16 gene] CTD PMID:28238834 Stx16 Rat cobalt dichloride increases expression ISO STX16 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of STX16 mRNA CTD PMID:19376846 Stx16 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of STX16 mRNA CTD PMID:30556269 Stx16 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of STX16 mRNA CTD PMID:30556269 Stx16 Rat copper(II) sulfate increases expression ISO STX16 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of STX16 mRNA CTD PMID:19549813 Stx16 Rat coumarin increases phosphorylation ISO STX16 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of STX16 protein CTD PMID:35688186 Stx16 Rat crocidolite asbestos decreases expression ISO STX16 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of STX16 mRNA CTD PMID:29523930 Stx16 Rat cyclosporin A increases expression ISO STX16 (Homo sapiens) 6480464 Cyclosporine results in increased expression of STX16 mRNA CTD PMID:20106945 and PMID:27989131 Stx16 Rat dorsomorphin multiple interactions ISO STX16 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of STX16 mRNA CTD PMID:27188386 Stx16 Rat doxorubicin decreases expression ISO STX16 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of STX16 mRNA CTD PMID:29803840 Stx16 Rat ethanol affects splicing ISO Stx16 (Mus musculus) 6480464 Ethanol affects the splicing of STX16 mRNA CTD PMID:30319688 Stx16 Rat ethyl methanesulfonate increases expression ISO STX16 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of STX16 mRNA CTD PMID:23649840 Stx16 Rat folic acid decreases expression ISO Stx16 (Mus musculus) 6480464 Folic Acid results in decreased expression of STX16 mRNA CTD PMID:25629700 Stx16 Rat FR900359 decreases phosphorylation ISO STX16 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of STX16 protein CTD PMID:37730182 Stx16 Rat furan increases methylation EXP 6480464 furan results in increased methylation of STX16 gene CTD PMID:22079235 Stx16 Rat ivermectin decreases expression ISO STX16 (Homo sapiens) 6480464 Ivermectin results in decreased expression of STX16 protein CTD PMID:32959892 Stx16 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of STX16 mRNA CTD PMID:28801915 Stx16 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of STX16 mRNA CTD PMID:30047161 Stx16 Rat methotrexate increases expression ISO STX16 (Homo sapiens) 6480464 Methotrexate results in increased expression of STX16 mRNA CTD PMID:17400583 Stx16 Rat methylmercury chloride increases expression ISO STX16 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of STX16 mRNA CTD PMID:26272509 Stx16 Rat methylmercury chloride multiple interactions ISO STX16 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of STX16 mRNA CTD PMID:27188386 Stx16 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of STX16 gene CTD PMID:33148267 Stx16 Rat nitrates multiple interactions ISO Stx16 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of STX16 mRNA CTD PMID:35964746 Stx16 Rat ozone multiple interactions ISO STX16 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of STX16 mRNA more ... CTD PMID:32699268 and PMID:35430440 Stx16 Rat paracetamol affects expression ISO Stx16 (Mus musculus) 6480464 Acetaminophen affects the expression of STX16 mRNA CTD PMID:17562736 Stx16 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of STX16 mRNA CTD PMID:33387578 Stx16 Rat paracetamol increases expression ISO STX16 (Homo sapiens) 6480464 Acetaminophen results in increased expression of STX16 mRNA CTD PMID:22230336 Stx16 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of STX16 gene CTD PMID:33148267 Stx16 Rat quercetin increases expression ISO STX16 (Homo sapiens) 6480464 Quercetin results in increased expression of STX16 mRNA CTD PMID:21632981 Stx16 Rat raloxifene increases expression ISO STX16 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of STX16 mRNA CTD PMID:16497877 Stx16 Rat SB 431542 multiple interactions ISO STX16 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of STX16 mRNA CTD PMID:27188386 Stx16 Rat sodium arsenite decreases expression ISO STX16 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of STX16 mRNA CTD PMID:28595984 Stx16 Rat sodium arsenite multiple interactions ISO STX16 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of STX16 mRNA CTD PMID:39836092 Stx16 Rat sodium arsenite increases expression ISO STX16 (Homo sapiens) 6480464 sodium arsenite results in increased expression of STX16 mRNA CTD PMID:38568856 Stx16 Rat sodium dichromate increases expression ISO Stx16 (Mus musculus) 6480464 sodium bichromate results in increased expression of STX16 mRNA CTD PMID:31558096 Stx16 Rat sunitinib increases expression ISO STX16 (Homo sapiens) 6480464 Sunitinib results in increased expression of STX16 mRNA CTD PMID:31533062 Stx16 Rat tamibarotene affects expression ISO STX16 (Homo sapiens) 6480464 tamibarotene affects the expression of STX16 mRNA CTD PMID:15498508 Stx16 Rat triphenyl phosphate affects expression ISO STX16 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of STX16 mRNA CTD PMID:37042841 Stx16 Rat valproic acid affects expression ISO Stx16 (Mus musculus) 6480464 Valproic Acid affects the expression of STX16 mRNA CTD PMID:17963808 Stx16 Rat valproic acid affects expression ISO STX16 (Homo sapiens) 6480464 Valproic Acid affects the expression of STX16 mRNA CTD PMID:25979313 Stx16 Rat valproic acid increases expression ISO STX16 (Homo sapiens) 6480464 Valproic Acid results in increased expression of STX16 mRNA CTD PMID:23179753 and PMID:28001369 Stx16 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of STX16 mRNA CTD PMID:23034163 Stx16 Rat zinc atom decreases expression ISO STX16 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of STX16 mRNA CTD PMID:22171008 Stx16 Rat zinc(0) decreases expression ISO STX16 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of STX16 mRNA CTD PMID:22171008 Stx16 Rat zoledronic acid increases expression ISO STX16 (Homo sapiens) 6480464 zoledronic acid results in increased expression of STX16 mRNA CTD PMID:20977926
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amphetamine (EXP) arsane (ISO) arsenic atom (ISO) atrazine (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) caffeine (ISO) CGP 52608 (ISO) cobalt dichloride (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) coumarin (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) dorsomorphin (ISO) doxorubicin (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) FR900359 (ISO) furan (EXP) ivermectin (ISO) manganese(II) chloride (EXP) methimazole (EXP) methotrexate (ISO) methylmercury chloride (ISO) N,N-diethyl-m-toluamide (EXP) nitrates (ISO) ozone (ISO) paracetamol (EXP,ISO) permethrin (EXP) quercetin (ISO) raloxifene (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sunitinib (ISO) tamibarotene (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
Cellular Component
cytoplasm (IEA,ISO) cytosol (IEA,ISO) endomembrane system (IBA) endoplasmic reticulum (ISO) Golgi apparatus (IEA,ISO) Golgi cisterna (IEA,ISO) Golgi membrane (IEA) intracellular membrane-bounded organelle (IEA,ISO) membrane (IEA,ISO) perinuclear region of cytoplasm (IEA,ISO) SNARE complex (IBA,IEA,ISO) synaptic vesicle membrane (EXP,IDA,IEP) trans-Golgi network (IEA,ISO)
Stx16 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 183,271,417 - 183,300,746 (+) NCBI GRCr8 mRatBN7.2 3 162,853,764 - 162,882,489 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 162,853,782 - 162,882,489 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 166,652,863 - 166,681,542 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 175,151,075 - 175,179,478 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 172,893,705 - 172,922,383 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 172,154,739 - 172,183,699 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 172,154,754 - 172,183,732 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 178,206,507 - 178,235,429 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 164,995,189 - 165,022,884 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 164,901,023 - 164,937,604 (+) NCBI Celera 3 162,030,293 - 162,057,164 (+) NCBI Celera Cytogenetic Map 3 q43 NCBI
STX16 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 58,651,283 - 58,679,526 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 58,651,272 - 58,679,526 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 57,226,339 - 57,254,582 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 56,659,734 - 56,687,988 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 56,659,733 - 56,687,986 NCBI Celera 20 53,966,805 - 53,995,061 (+) NCBI Celera Cytogenetic Map 20 q13.32 NCBI HuRef 20 54,010,737 - 54,039,011 (+) NCBI HuRef CHM1_1 20 57,127,816 - 57,156,091 (+) NCBI CHM1_1 T2T-CHM13v2.0 20 60,433,347 - 60,461,590 (+) NCBI T2T-CHM13v2.0
Stx16 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 173,918,052 - 173,941,564 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 173,918,101 - 173,941,564 (+) Ensembl GRCm39 Ensembl GRCm38 2 174,076,260 - 174,099,771 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 174,076,308 - 174,099,771 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 173,902,552 - 173,925,272 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 173,719,260 - 173,741,346 (+) NCBI MGSCv36 mm8 Celera 2 180,041,568 - 180,064,364 (+) NCBI Celera Cytogenetic Map 2 H4 NCBI cM Map 2 97.85 NCBI
Stx16 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955445 887,240 - 909,151 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955445 884,372 - 910,010 (-) NCBI ChiLan1.0 ChiLan1.0
NPEPL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 64,451,184 - 64,477,251 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 64,444,304 - 64,470,363 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 55,037,301 - 55,065,461 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 56,309,440 - 56,337,709 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 56,309,440 - 56,338,179 (+) Ensembl panpan1.1 panPan2
STX16 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 43,425,719 - 43,451,828 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 43,426,470 - 43,449,077 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 42,672,827 - 42,698,669 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 44,292,332 - 44,318,176 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 44,292,533 - 44,318,126 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 43,396,684 - 43,422,524 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 43,514,744 - 43,540,577 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 44,174,745 - 44,200,586 (+) NCBI UU_Cfam_GSD_1.0
STX16 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 58,840,006 - 58,873,241 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 58,839,982 - 58,873,396 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 66,106,367 - 66,135,008 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
STX16 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 5,462,910 - 5,489,416 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 5,460,383 - 5,488,693 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 53,513,523 - 53,542,430 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Stx16
.
Predicted Target Of
Count of predictions: 200 Count of miRNA genes: 133 Interacting mature miRNAs: 164 Transcripts: ENSRNOT00000066279 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12879876 Bw182 Body weight QTL 182 0.003 body mass (VT:0001259) body weight (CMO:0000012) 3 145925360 166177555 Rat 2301411 Bp320 Blood pressure QTL 320 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 145925360 166177555 Rat 2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 12879872 Cm97 Cardiac mass QTL 97 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 145925360 166177555 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 12879873 Cm96 Cardiac mass QTL 96 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 145925360 166177555 Rat 12879874 Cm98 Cardiac mass QTL 98 0.005 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 145925360 166177555 Rat 1298068 Bp167 Blood pressure QTL 167 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141074471 169034231 Rat 12879875 Kidm64 Kidney mass QTL 64 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 145925360 166177555 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 1300161 Rf10 Renal function QTL 10 3.57 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 3 161192952 169034231 Rat 8552791 Vie2 Viral induced encephalitis QTL 2 4.1 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 3 145956084 169034231 Rat 2317883 Alcrsp26 Alcohol response QTL 26 1.8 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 3 145526770 169034231 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 1578666 Vnigr1 Vascular neointimal growth QTL 1 4.6 artery morphology trait (VT:0002191) artery lumen area (CMO:0001409) 3 149040888 168026850 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 12879871 Am7 Aortic mass QTL 7 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 145925360 166177555 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat
RH132344
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 162,882,075 - 162,882,292 (+) MAPPER mRatBN7.2 Rnor_6.0 3 172,183,286 - 172,183,502 NCBI Rnor6.0 Rnor_5.0 3 178,235,016 - 178,235,232 UniSTS Rnor5.0 RGSC_v3.4 3 165,023,315 - 165,023,531 UniSTS RGSC3.4 Celera 3 162,057,595 - 162,057,811 UniSTS RH 3.4 Map 3 1499.2 UniSTS Cytogenetic Map 3 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066279 ⟹ ENSRNOP00000062099
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 162,853,803 - 162,882,489 (+) Ensembl Rnor_6.0 Ensembl 3 172,155,496 - 172,182,855 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000088286 ⟹ ENSRNOP00000073268
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 162,853,782 - 162,882,489 (+) Ensembl Rnor_6.0 Ensembl 3 172,154,754 - 172,183,732 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095901 ⟹ ENSRNOP00000096219
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 162,853,818 - 162,878,601 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106302 ⟹ ENSRNOP00000083230
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 162,863,441 - 162,882,489 (+) Ensembl
RefSeq Acc Id:
NM_001401893 ⟹ NP_001388822
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 183,272,071 - 183,300,746 (+) NCBI mRatBN7.2 3 162,853,814 - 162,882,489 (+) NCBI
RefSeq Acc Id:
NM_001401894 ⟹ NP_001388823
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 183,272,071 - 183,300,746 (+) NCBI mRatBN7.2 3 162,853,814 - 162,882,489 (+) NCBI
RefSeq Acc Id:
XM_006235694 ⟹ XP_006235756
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 183,271,417 - 183,300,746 (+) NCBI mRatBN7.2 3 162,853,770 - 162,882,489 (+) NCBI Rnor_6.0 3 172,154,739 - 172,183,699 (+) NCBI Rnor_5.0 3 178,206,507 - 178,235,429 (+) NCBI
Sequence:
GAGGGCTGGGGAACGCTAGAGCCCGGGACCACAGCACGGAAGCCGGCTTGGGCAGGGTTGCAGCCAGATCCCGGGATGGAGGGTTGCCGGTGAAGAGGATTGAAGAGGAGTGAGGAGGCCGGGGAGGC
hide sequence
RefSeq Acc Id:
XM_006235695 ⟹ XP_006235757
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 183,271,417 - 183,300,746 (+) NCBI mRatBN7.2 3 162,853,771 - 162,882,489 (+) NCBI Rnor_6.0 3 172,154,740 - 172,183,699 (+) NCBI Rnor_5.0 3 178,206,507 - 178,235,429 (+) NCBI
Sequence:
AGGGCTGGGGAACGCTAGAGCCCGGGACCACAGCACGGAAGCCGGCTTGGGCAGGGTTGCAGCCAGATCCCGGGATGGAGGGTTGCCGGTGAAGAGGATTGAAGAGGAGTGAGGAGGCCGGGGAGGCA
hide sequence
RefSeq Acc Id:
XR_005501944
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 183,271,417 - 183,294,706 (+) NCBI mRatBN7.2 3 162,853,764 - 162,876,449 (+) NCBI
RefSeq Acc Id:
XP_006235756 ⟸ XM_006235694
- Peptide Label:
isoform X1
- UniProtKB:
D3Z9R7 (UniProtKB/TrEMBL), A0A8I6AQ84 (UniProtKB/TrEMBL)
- Sequence:
MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHTTSSPLHSRSIAALADDRMALVSGISLDPEAAIGVTKRSPPKWVDGVDEIQYDVGRIKQKMRELASLHDKHLNRPTLDDSSEEEHAIEITTQEVTQL
hide sequence
RefSeq Acc Id:
XP_006235757 ⟸ XM_006235695
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5ZW54 (UniProtKB/TrEMBL)
- Sequence:
MATRRLTDAFLLLRNNSIQNRQLLAEQELDELADDRMALVSGISLDPEAAIGVTKRSPPKWVDGVDEIQYDVGRIKQKMRELASLHDKHLNRPTLDDSSEEEHAIEITTQEVTQLFHRCQRAVQALPS
hide sequence
Ensembl Acc Id:
ENSRNOP00000062099 ⟸ ENSRNOT00000066279
Ensembl Acc Id:
ENSRNOP00000073268 ⟸ ENSRNOT00000088286
Ensembl Acc Id:
ENSRNOP00000096219 ⟸ ENSRNOT00000095901
Ensembl Acc Id:
ENSRNOP00000083230 ⟸ ENSRNOT00000106302
RefSeq Acc Id:
NP_001388822 ⟸ NM_001401893
- Peptide Label:
isoform 1
- UniProtKB:
A0A8I5ZW54 (UniProtKB/TrEMBL), A0A0G2K528 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001388823 ⟸ NM_001401894
- Peptide Label:
isoform 2
- UniProtKB:
A0A8I6AQ84 (UniProtKB/TrEMBL)
RGD ID: 13692725 Promoter ID: EPDNEW_R3242 Type: initiation region Name: Stx16_1 Description: syntaxin 16 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 172,154,771 - 172,154,831 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-05-24
Stx16
syntaxin 16
LOC679159
similar to Syntaxin-16 (Syn16)
Data merged from RGD:1591838
1643240 APPROVED
2008-04-30
Stx16
syntaxin 16
Stx16_predicted
syntaxin 16 (predicted)
'predicted' is removed
2292626 APPROVED
2006-11-20
LOC679159
similar to Syntaxin-16 (Syn16)
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-12
Stx16_predicted
syntaxin 16 (predicted)
Symbol and Name status set to approved
70820 APPROVED
