Symbol:
Anks1b
Name:
ankyrin repeat and sterile alpha motif domain containing 1B
RGD ID:
1565556
Description:
Predicted to enable ephrin receptor binding activity. Involved in postsynapse to nucleus signaling pathway. Acts upstream of or within receptor localization to synapse. Is active in several cellular components, including hippocampal mossy fiber to CA3 synapse; postsynaptic density, intracellular component; and presynaptic cytosol. Orthologous to human ANKS1B (ankyrin repeat and sterile alpha motif domain containing 1B); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; amitrole.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AIDA-1; amyloid-beta protein intracellular domain-associated protein 1; Ankyrin repeat and sterile alpha motif domain-containing protein 1B; E2A-PBX1-associated protein; EB-1; LOC314721; RGD1565556; similar to cajalin 2 isoform a
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 26,200,649 - 27,366,552 (+) NCBI GRCr8 mRatBN7.2 7 24,313,339 - 25,479,307 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 24,312,843 - 25,477,693 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 26,308,631 - 27,472,150 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 28,470,984 - 29,634,542 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 28,248,382 - 29,411,942 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 30,507,135 - 31,684,604 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 30,699,476 - 31,681,182 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 30,603,416 - 31,776,175 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 26,749,708 - 27,914,155 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 21,458,045 - 22,603,947 (+) NCBI Celera Cytogenetic Map 7 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Anks1b Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Anks1b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Anks1b Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Anks1b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Anks1b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ANKS1B mRNA CTD PMID:32109520 Anks1b Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Anks1b Rat 3,4-methylenedioxymethamphetamine increases expression ISO Anks1b (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of ANKS1B mRNA CTD PMID:20188158 Anks1b Rat 4,4'-sulfonyldiphenol affects methylation ISO Anks1b (Mus musculus) 6480464 bisphenol S affects the methylation of ANKS1B exon CTD PMID:33297965 Anks1b Rat aflatoxin B1 decreases methylation ISO ANKS1B (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ANKS1B intron CTD PMID:30157460 Anks1b Rat aflatoxin B1 decreases expression ISO ANKS1B (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ANKS1B mRNA CTD PMID:32234424 Anks1b Rat Aflatoxin B2 alpha increases methylation ISO ANKS1B (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of ANKS1B intron CTD PMID:30157460 Anks1b Rat aldehydo-D-glucose multiple interactions ISO Anks1b (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of ANKS1B mRNA CTD PMID:37567420 Anks1b Rat all-trans-retinoic acid decreases expression ISO ANKS1B (Homo sapiens) 6480464 Tretinoin results in decreased expression of ANKS1B mRNA CTD PMID:21934132 Anks1b Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of ANKS1B mRNA CTD PMID:38685447 Anks1b Rat aristolochic acid A decreases expression ISO ANKS1B (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ANKS1B mRNA CTD PMID:33212167 Anks1b Rat arsane affects methylation ISO ANKS1B (Homo sapiens) 6480464 Arsenic affects the methylation of ANKS1B gene CTD PMID:25304211 Anks1b Rat arsenic atom affects methylation ISO ANKS1B (Homo sapiens) 6480464 Arsenic affects the methylation of ANKS1B gene CTD PMID:25304211 Anks1b Rat arsenous acid decreases expression ISO Anks1b (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of ANKS1B mRNA CTD PMID:24831965 Anks1b Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of ANKS1B gene CTD PMID:28931070 and PMID:35440735 Anks1b Rat belinostat multiple interactions ISO ANKS1B (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ANKS1B mRNA CTD PMID:27188386 Anks1b Rat benzo[a]pyrene increases methylation ISO ANKS1B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ANKS1B exon and Benzo(a)pyrene results in increased methylation of ANKS1B promoter CTD PMID:27901495 Anks1b Rat benzo[a]pyrene increases methylation ISO Anks1b (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of ANKS1B intron CTD PMID:27901495 Anks1b Rat benzo[a]pyrene affects methylation ISO ANKS1B (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ANKS1B intron CTD PMID:30157460 Anks1b Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ANKS1B gene CTD PMID:28505145 Anks1b Rat bisphenol A decreases expression ISO Anks1b (Mus musculus) 6480464 bisphenol A results in decreased expression of ANKS1B mRNA CTD PMID:32156529 Anks1b Rat bisphenol A decreases methylation ISO ANKS1B (Homo sapiens) 6480464 bisphenol A results in decreased methylation of ANKS1B gene CTD PMID:31601247 Anks1b Rat bisphenol A increases expression ISO ANKS1B (Homo sapiens) 6480464 bisphenol A results in increased expression of ANKS1B mRNA CTD PMID:31715268 Anks1b Rat bisphenol F multiple interactions ISO ANKS1B (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of ANKS1B gene CTD PMID:31601247 Anks1b Rat butanal decreases expression ISO ANKS1B (Homo sapiens) 6480464 butyraldehyde results in decreased expression of ANKS1B mRNA CTD PMID:26079696 Anks1b Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of ANKS1B mRNA CTD PMID:33453195 Anks1b Rat cadmium dichloride decreases expression ISO ANKS1B (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of ANKS1B mRNA CTD PMID:38568856 Anks1b Rat cadmium dichloride increases expression ISO Anks1b (Mus musculus) 6480464 Cadmium Chloride results in increased expression of ANKS1B mRNA CTD PMID:24982889 Anks1b Rat CGP 52608 multiple interactions ISO ANKS1B (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ANKS1B gene] CTD PMID:28238834 Anks1b Rat cisplatin multiple interactions ISO ANKS1B (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of ANKS1B mRNA CTD PMID:27392435 Anks1b Rat cisplatin increases expression ISO ANKS1B (Homo sapiens) 6480464 Cisplatin results in increased expression of ANKS1B mRNA CTD PMID:27392435 Anks1b Rat cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of ANKS1B mRNA CTD PMID:17898221 Anks1b Rat crocidolite asbestos increases expression ISO Anks1b (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of ANKS1B mRNA CTD PMID:29279043 Anks1b Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of ANKS1B mRNA CTD PMID:26577399 Anks1b Rat D-glucose multiple interactions ISO Anks1b (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of ANKS1B mRNA CTD PMID:37567420 Anks1b Rat DDE decreases expression ISO ANKS1B (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of ANKS1B mRNA CTD PMID:38568856 Anks1b Rat DDT increases methylation EXP 6480464 DDT results in increased methylation of ANKS1B gene CTD PMID:30207508 Anks1b Rat diarsenic trioxide decreases expression ISO Anks1b (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of ANKS1B mRNA CTD PMID:24831965 Anks1b Rat diquat decreases expression ISO Anks1b (Mus musculus) 6480464 Diquat results in decreased expression of ANKS1B mRNA CTD PMID:36851058 Anks1b Rat dorsomorphin multiple interactions ISO ANKS1B (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Anks1b Rat doxorubicin increases expression ISO Anks1b (Mus musculus) 6480464 Doxorubicin results in increased expression of ANKS1B mRNA CTD PMID:36227756 Anks1b Rat entinostat decreases expression ISO ANKS1B (Homo sapiens) 6480464 entinostat results in decreased expression of ANKS1B mRNA CTD PMID:26272509 Anks1b Rat entinostat multiple interactions ISO ANKS1B (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ANKS1B mRNA CTD PMID:27188386 Anks1b Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of ANKS1B mRNA CTD PMID:31078653 Anks1b Rat ethanol affects splicing ISO Anks1b (Mus musculus) 6480464 Ethanol affects the splicing of ANKS1B mRNA CTD PMID:30319688 Anks1b Rat fenamidone decreases expression ISO Anks1b (Mus musculus) 6480464 fenamidone results in decreased expression of ANKS1B mRNA CTD PMID:27029645 Anks1b Rat fructose multiple interactions ISO Anks1b (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of ANKS1B mRNA CTD PMID:37567420 Anks1b Rat fulvestrant increases methylation ISO ANKS1B (Homo sapiens) 6480464 Fulvestrant results in increased methylation of ANKS1B gene CTD PMID:31601247 Anks1b Rat fulvestrant multiple interactions ISO ANKS1B (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of ANKS1B gene CTD PMID:31601247 Anks1b Rat glucose multiple interactions ISO Anks1b (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of ANKS1B mRNA CTD PMID:37567420 Anks1b Rat ivermectin increases expression ISO ANKS1B (Homo sapiens) 6480464 Ivermectin results in increased expression of ANKS1B protein CTD PMID:32959892 Anks1b Rat maneb multiple interactions ISO Anks1b (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of ANKS1B mRNA CTD PMID:36117858 Anks1b Rat methamphetamine decreases expression ISO Anks1b (Mus musculus) 6480464 Methamphetamine results in decreased expression of ANKS1B mRNA CTD PMID:26307267 Anks1b Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ANKS1B gene CTD PMID:35440735 Anks1b Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of ANKS1B gene CTD PMID:33148267 Anks1b Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of ANKS1B mRNA CTD PMID:26720608 Anks1b Rat O-methyleugenol decreases expression ISO ANKS1B (Homo sapiens) 6480464 methyleugenol results in decreased expression of ANKS1B mRNA CTD PMID:32234424 Anks1b Rat ozone decreases expression ISO Anks1b (Mus musculus) 6480464 Ozone results in decreased expression of ANKS1B mRNA CTD PMID:31626304 Anks1b Rat panobinostat multiple interactions ISO ANKS1B (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ANKS1B mRNA CTD PMID:27188386 Anks1b Rat paraquat multiple interactions ISO Anks1b (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of ANKS1B mRNA CTD PMID:36117858 Anks1b Rat PCB138 multiple interactions ISO Anks1b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Anks1b Rat pentanal decreases expression ISO ANKS1B (Homo sapiens) 6480464 pentanal results in decreased expression of ANKS1B mRNA CTD PMID:26079696 Anks1b Rat perfluorohexanesulfonic acid decreases expression ISO ANKS1B (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in decreased expression of ANKS1B mRNA CTD PMID:25812627 Anks1b Rat perfluorohexanesulfonic acid decreases expression ISO Anks1b (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of ANKS1B mRNA CTD PMID:37995155 Anks1b Rat perfluorononanoic acid decreases expression ISO ANKS1B (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of ANKS1B mRNA CTD PMID:25812627 Anks1b Rat perfluorooctane-1-sulfonic acid decreases expression ISO ANKS1B (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of ANKS1B mRNA CTD PMID:25812627 Anks1b Rat perfluorooctanoic acid decreases expression ISO ANKS1B (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of ANKS1B mRNA CTD PMID:25812627 Anks1b Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of ANKS1B gene CTD PMID:33148267 Anks1b Rat phenylmercury acetate increases expression ISO ANKS1B (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of ANKS1B mRNA CTD PMID:26272509 Anks1b Rat phenylmercury acetate multiple interactions ISO ANKS1B (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ANKS1B mRNA CTD PMID:27188386 Anks1b Rat potassium dichromate increases expression ISO Anks1b (Mus musculus) 6480464 Potassium Dichromate results in increased expression of ANKS1B mRNA CTD PMID:23608068 Anks1b Rat rifampicin decreases expression ISO ANKS1B (Homo sapiens) 6480464 Rifampin results in decreased expression of ANKS1B mRNA CTD PMID:24552687 Anks1b Rat SB 431542 multiple interactions ISO ANKS1B (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Anks1b Rat sodium arsenite affects methylation ISO ANKS1B (Homo sapiens) 6480464 sodium arsenite affects the methylation of ANKS1B gene CTD PMID:28589171 Anks1b Rat sodium arsenite decreases expression ISO Anks1b (Mus musculus) 6480464 sodium arsenite results in decreased expression of ANKS1B mRNA CTD PMID:37682722 Anks1b Rat sodium arsenite decreases expression ISO ANKS1B (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ANKS1B mRNA CTD PMID:29301061 and PMID:34032870 Anks1b Rat sodium fluoride decreases expression ISO Anks1b (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of ANKS1B mRNA CTD PMID:27862939 Anks1b Rat temozolomide increases expression ISO ANKS1B (Homo sapiens) 6480464 Temozolomide results in increased expression of ANKS1B mRNA CTD PMID:31758290 Anks1b Rat thiram decreases expression ISO ANKS1B (Homo sapiens) 6480464 Thiram results in decreased expression of ANKS1B mRNA CTD PMID:38568856 Anks1b Rat titanium dioxide decreases methylation ISO Anks1b (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ANKS1B gene and titanium dioxide results in decreased methylation of ANKS1B promoter CTD PMID:35295148 Anks1b Rat titanium dioxide increases methylation ISO Anks1b (Mus musculus) 6480464 titanium dioxide results in increased methylation of ANKS1B gene CTD PMID:35295148 Anks1b Rat triclosan increases expression ISO ANKS1B (Homo sapiens) 6480464 Triclosan results in increased expression of ANKS1B mRNA CTD PMID:30510588 Anks1b Rat triptonide increases expression ISO Anks1b (Mus musculus) 6480464 triptonide results in increased expression of ANKS1B mRNA CTD PMID:33045310 Anks1b Rat urethane increases expression ISO ANKS1B (Homo sapiens) 6480464 Urethane results in increased expression of ANKS1B mRNA CTD PMID:28818685 Anks1b Rat valproic acid increases expression ISO ANKS1B (Homo sapiens) 6480464 Valproic Acid results in increased expression of ANKS1B mRNA CTD PMID:28001369 Anks1b Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of ANKS1B mRNA CTD PMID:19015723 Anks1b Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of ANKS1B gene CTD PMID:31079544
2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (EXP) belinostat (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium dichloride (EXP,ISO) CGP 52608 (ISO) cisplatin (ISO) cocaine (EXP) crocidolite asbestos (ISO) Cuprizon (EXP) D-glucose (ISO) DDE (ISO) DDT (EXP) diarsenic trioxide (ISO) diquat (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (EXP,ISO) fenamidone (ISO) fructose (ISO) fulvestrant (ISO) glucose (ISO) ivermectin (ISO) maneb (ISO) methamphetamine (ISO) methoxychlor (EXP) N,N-diethyl-m-toluamide (EXP) nitrofen (EXP) O-methyleugenol (ISO) ozone (ISO) panobinostat (ISO) paraquat (ISO) PCB138 (ISO) pentanal (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) permethrin (EXP) phenylmercury acetate (ISO) potassium dichromate (ISO) rifampicin (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium fluoride (ISO) temozolomide (ISO) thiram (ISO) titanium dioxide (ISO) triclosan (ISO) triptonide (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
Anks1b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 26,200,649 - 27,366,552 (+) NCBI GRCr8 mRatBN7.2 7 24,313,339 - 25,479,307 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 24,312,843 - 25,477,693 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 26,308,631 - 27,472,150 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 28,470,984 - 29,634,542 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 28,248,382 - 29,411,942 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 30,507,135 - 31,684,604 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 30,699,476 - 31,681,182 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 30,603,416 - 31,776,175 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 26,749,708 - 27,914,155 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 21,458,045 - 22,603,947 (+) NCBI Celera Cytogenetic Map 7 q13 NCBI
ANKS1B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 98,734,786 - 99,984,936 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 98,726,457 - 99,984,936 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 99,128,564 - 100,378,714 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 97,653,202 - 98,902,563 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 12 98,793,966 - 100,043,704 (-) NCBI Celera Cytogenetic Map 12 q23.1 NCBI HuRef 12 96,189,664 - 97,280,648 (-) NCBI HuRef CHM1_1 12 99,093,509 - 100,344,110 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 98,707,730 - 99,946,157 (-) NCBI T2T-CHM13v2.0
Anks1b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 89,707,238 - 90,809,162 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 89,709,371 - 90,809,162 (+) Ensembl GRCm39 Ensembl GRCm38 10 89,872,915 - 90,973,300 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 89,873,509 - 90,973,300 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 89,336,254 - 90,435,730 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 89,302,828 - 90,403,103 (+) NCBI MGSCv36 mm8 Celera 10 91,877,745 - 92,966,422 (+) NCBI Celera Cytogenetic Map 10 C2 NCBI cM Map 10 45.28 NCBI
Anks1b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 34,700,551 - 35,775,960 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 34,701,613 - 35,776,076 (-) NCBI ChiLan1.0 ChiLan1.0
ANKS1B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 106,792,125 - 108,043,418 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 106,791,492 - 108,039,804 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 96,313,293 - 97,559,597 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 99,736,914 - 100,968,737 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 99,737,252 - 100,968,475 (-) Ensembl panpan1.1 panPan2
ANKS1B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 38,128,114 - 39,186,341 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 38,129,140 - 39,186,399 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 38,508,921 - 39,565,304 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 38,790,754 - 39,848,495 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 38,790,769 - 39,235,662 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 38,062,386 - 39,106,374 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 38,155,275 - 39,212,769 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 38,428,996 - 39,486,471 (-) NCBI UU_Cfam_GSD_1.0
Anks1b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 20,743,191 - 21,793,888 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936492 13,753,824 - 14,803,766 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936492 13,753,605 - 14,805,539 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ANKS1B
ANKS1B
Anks1b
.
Predicted Target Of
Count of predictions: 224 Count of miRNA genes: 77 Interacting mature miRNAs: 80 Transcripts: ENSRNOT00000038488, ENSRNOT00000038501, ENSRNOT00000052319, ENSRNOT00000059269 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354644 Spl4 Serum phospholipid level QTL 4 4.9 blood phospholipid amount (VT:0006084) blood phospholipid level (CMO:0001169) 7 19654317 49753746 Rat 7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 1354637 Scl30 Serum cholesterol level QTL 30 3.7 blood cholesterol amount (VT:0000180) blood total cholesterol level (CMO:0000051) 7 19654317 49753746 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 2290372 Gluco33 Glucose level QTL 33 2.71 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 20555705 29891047 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 1582260 Bw72 Body weight QTL 72 3.2 0.0043 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582261 Bw69 Body weight QTL 69 3.2 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582262 Bw75 Body weight QTL 75 3 0.0038 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 61369 Mcs2 Mammary carcinoma susceptibility QTL 2 3.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 19032807 35526300 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat 70207 Niddm31 Non-insulin dependent diabetes mellitus QTL 31 3.9 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 18169505 26029351 Rat
D7Rat47
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 25,223,289 - 25,223,463 (+) MAPPER mRatBN7.2 Rnor_6.0 7 31,427,655 - 31,427,828 NCBI Rnor6.0 Rnor_5.0 7 31,518,951 - 31,519,124 UniSTS Rnor5.0 RGSC_v3.4 7 27,660,931 - 27,661,104 RGD RGSC3.4 RGSC_v3.4 7 27,660,932 - 27,661,105 UniSTS RGSC3.4 RGSC_v3.1 7 27,681,202 - 27,681,375 RGD RH 3.4 Map 7 148.5 RGD RH 3.4 Map 7 148.5 UniSTS RH 2.0 Map 7 141.7 RGD FHH x ACI Map 7 7.4699 RGD Cytogenetic Map 7 q13 UniSTS
D7Rat194
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 25,438,526 - 25,438,669 (+) MAPPER mRatBN7.2 Rnor_6.0 7 31,642,803 - 31,642,945 NCBI Rnor6.0 Rnor_5.0 7 31,734,050 - 31,734,192 UniSTS Rnor5.0 RGSC_v3.4 7 27,877,351 - 27,877,494 RGD RGSC3.4 RGSC_v3.4 7 27,877,352 - 27,877,494 UniSTS RGSC3.4 RGSC_v3.1 7 27,897,622 - 27,897,765 RGD Celera 7 22,565,821 - 22,565,963 UniSTS FHH x ACI Map 7 7.4699 RGD FHH x ACI Map 7 7.4699 UniSTS Cytogenetic Map 7 q13 UniSTS
D7Got16
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 24,710,335 - 24,710,736 (+) MAPPER mRatBN7.2 mRatBN7.2 7 24,710,577 - 24,710,736 (+) MAPPER mRatBN7.2 Rnor_6.0 7 30,904,249 - 30,904,405 NCBI Rnor6.0 Rnor_6.0 7 30,903,969 - 30,904,405 NCBI Rnor6.0 Rnor_5.0 7 31,001,207 - 31,001,643 UniSTS Rnor5.0 Rnor_5.0 7 31,001,487 - 31,001,643 UniSTS Rnor5.0 RGSC_v3.4 7 27,153,505 - 27,153,661 UniSTS RGSC3.4 RGSC_v3.4 7 27,153,504 - 27,153,661 RGD RGSC3.4 RGSC_v3.1 7 27,173,776 - 27,173,932 RGD Celera 7 21,842,997 - 21,843,167 UniSTS RH 3.4 Map 7 141.3 UniSTS RH 3.4 Map 7 141.3 RGD RH 2.0 Map 7 142.1 RGD Cytogenetic Map 7 q13 UniSTS
BE102489
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 25,216,031 - 25,216,190 (+) MAPPER mRatBN7.2 Rnor_6.0 7 31,409,056 - 31,409,214 NCBI Rnor6.0 Rnor_5.0 7 31,503,629 - 31,503,787 UniSTS Rnor5.0 RGSC_v3.4 7 27,653,844 - 27,654,002 UniSTS RGSC3.4 Celera 7 22,343,404 - 22,343,562 UniSTS RH 3.4 Map 7 147.1 UniSTS Cytogenetic Map 7 q13 UniSTS
RH138629
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 25,041,107 - 25,041,256 (+) MAPPER mRatBN7.2 Rnor_6.0 7 31,232,859 - 31,233,007 NCBI Rnor6.0 Rnor_5.0 7 31,327,432 - 31,327,580 UniSTS Rnor5.0 RGSC_v3.4 7 27,474,547 - 27,474,695 UniSTS RGSC3.4 Celera 7 22,167,250 - 22,167,398 UniSTS RH 3.4 Map 7 143.8 UniSTS Cytogenetic Map 7 q13 UniSTS
RH144012
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 25,475,417 - 25,475,517 (+) MAPPER mRatBN7.2 Rnor_6.0 7 31,680,715 - 31,680,814 NCBI Rnor6.0 Rnor_5.0 7 31,772,291 - 31,772,390 UniSTS Rnor5.0 RGSC_v3.4 7 27,913,782 - 27,913,881 UniSTS RGSC3.4 Celera 7 22,601,672 - 22,601,771 UniSTS RH 3.4 Map 7 153.9 UniSTS Cytogenetic Map 7 q13 UniSTS
RH144380
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 24,314,731 - 24,314,902 (+) MAPPER mRatBN7.2 Rnor_6.0 7 30,507,738 - 30,507,908 NCBI Rnor6.0 Rnor_5.0 7 30,604,019 - 30,604,189 UniSTS Rnor5.0 RGSC_v3.4 7 26,750,311 - 26,750,481 UniSTS RGSC3.4 Celera 7 21,458,648 - 21,458,818 UniSTS RH 3.4 Map 7 144.5 UniSTS Cytogenetic Map 7 q13 UniSTS
RH144500
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 25,456,657 - 25,456,774 (+) MAPPER mRatBN7.2 Rnor_6.0 7 31,660,932 - 31,661,048 NCBI Rnor6.0 Rnor_5.0 7 31,752,179 - 31,752,295 UniSTS Rnor5.0 RGSC_v3.4 7 27,895,481 - 27,895,597 UniSTS RGSC3.4 Celera 7 22,584,008 - 22,584,124 UniSTS RH 3.4 Map 7 152.6 UniSTS Cytogenetic Map 7 q13 UniSTS
BF387129
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 25,218,766 - 25,218,917 (+) MAPPER mRatBN7.2 Rnor_6.0 7 31,411,790 - 31,411,940 NCBI Rnor6.0 Rnor_5.0 7 31,506,363 - 31,506,513 UniSTS Rnor5.0 RGSC_v3.4 7 27,656,578 - 27,656,728 UniSTS RGSC3.4 Celera 7 22,346,133 - 22,346,283 UniSTS RH 3.4 Map 7 148.6 UniSTS Cytogenetic Map 7 q13 UniSTS
BF387391
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 25,222,358 - 25,222,551 (+) MAPPER mRatBN7.2 Rnor_6.0 7 31,426,724 - 31,426,916 NCBI Rnor6.0 Rnor_5.0 7 31,518,020 - 31,518,212 UniSTS Rnor5.0 RGSC_v3.4 7 27,660,001 - 27,660,193 UniSTS RGSC3.4 Celera 7 22,349,725 - 22,349,917 UniSTS RH 3.4 Map 7 153.01 UniSTS Cytogenetic Map 7 q13 UniSTS
BE102988
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 25,236,543 - 25,236,736 (+) MAPPER mRatBN7.2 Rnor_6.0 7 31,439,931 - 31,440,123 NCBI Rnor6.0 Rnor_5.0 7 31,531,227 - 31,531,419 UniSTS Rnor5.0 RGSC_v3.4 7 27,674,185 - 27,674,377 UniSTS RGSC3.4 Celera 7 22,363,968 - 22,364,160 UniSTS RH 3.4 Map 7 147.4 UniSTS Cytogenetic Map 7 q13 UniSTS
BE097681
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 25,226,782 - 25,226,965 (+) MAPPER mRatBN7.2 Rnor_6.0 7 31,431,149 - 31,431,331 NCBI Rnor6.0 Rnor_6.0 7 31,418,492 - 31,418,674 NCBI Rnor6.0 Rnor_5.0 7 31,522,445 - 31,522,627 UniSTS Rnor5.0 Rnor_5.0 7 31,513,065 - 31,513,247 UniSTS Rnor5.0 RGSC_v3.4 7 27,664,426 - 27,664,608 UniSTS RGSC3.4 Celera 7 22,354,164 - 22,354,346 UniSTS RH 3.4 Map 7 145.2 UniSTS Cytogenetic Map 7 q13 UniSTS
BF401678
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 25,275,488 - 25,275,669 (+) MAPPER mRatBN7.2 Rnor_6.0 7 31,478,858 - 31,479,038 NCBI Rnor6.0 Rnor_5.0 7 31,570,154 - 31,570,334 UniSTS Rnor5.0 RGSC_v3.4 7 27,713,121 - 27,713,301 UniSTS RGSC3.4 Celera 7 22,402,903 - 22,403,083 UniSTS RH 3.4 Map 7 152.3 UniSTS Cytogenetic Map 7 q13 UniSTS
BF403875
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 25,304,898 - 25,305,108 (+) MAPPER mRatBN7.2 Rnor_6.0 7 31,508,324 - 31,508,533 NCBI Rnor6.0 Rnor_5.0 7 31,599,571 - 31,599,780 UniSTS Rnor5.0 RGSC_v3.4 7 27,743,732 - 27,743,941 UniSTS RGSC3.4 Celera 7 22,432,084 - 22,432,293 UniSTS Cytogenetic Map 7 q13 UniSTS
RH136686
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 25,476,740 - 25,476,923 (+) MAPPER mRatBN7.2 Rnor_6.0 7 31,682,038 - 31,682,220 NCBI Rnor6.0 Rnor_5.0 7 31,773,614 - 31,773,796 UniSTS Rnor5.0 RGSC_v3.4 7 27,915,105 - 27,915,287 UniSTS RGSC3.4 Celera 7 22,602,995 - 22,603,177 UniSTS RH 3.4 Map 7 176.0 UniSTS Cytogenetic Map 7 q13 UniSTS
AW533069
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 25,226,222 - 25,226,430 (+) MAPPER mRatBN7.2 Rnor_6.0 7 31,430,587 - 31,430,794 NCBI Rnor6.0 Rnor_5.0 7 31,521,883 - 31,522,090 UniSTS Rnor5.0 RGSC_v3.4 7 27,663,864 - 27,664,071 UniSTS RGSC3.4 Celera 7 22,353,511 - 22,353,718 UniSTS RH 3.4 Map 7 148.4 UniSTS Cytogenetic Map 7 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
8
34
112
52
52
21
24
21
6
160
77
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000059269 ⟹ ENSRNOP00000056036
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 24,313,333 - 25,476,889 (+) Ensembl Rnor_6.0 Ensembl 7 30,699,476 - 31,681,182 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102313 ⟹ ENSRNOP00000084534
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 24,312,843 - 25,477,693 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113343 ⟹ ENSRNOP00000083101
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 25,072,360 - 25,476,889 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114777 ⟹ ENSRNOP00000078170
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 25,001,474 - 25,472,983 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117411 ⟹ ENSRNOP00000089631
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 25,072,579 - 25,477,693 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119672 ⟹ ENSRNOP00000083437
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 25,072,579 - 25,477,693 (+) Ensembl
RefSeq Acc Id:
NM_001271371 ⟹ NP_001258300
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,649 - 27,366,550 (+) NCBI mRatBN7.2 7 24,313,339 - 25,479,300 (+) NCBI Rnor_6.0 7 30,507,135 - 31,682,990 (+) NCBI Rnor_5.0 7 30,603,416 - 31,776,175 (+) NCBI Celera 7 21,458,045 - 22,603,947 (+) NCBI
Sequence:
ATGGGGAAGGACCAGGAGCTGCTAGAGGCTGCTCGTACTGGCAATGTGGCTCTGGTCGAGAAACTCCTATCTGGCAGGAAAGGAGGGATCCTGGGTGGTGGATCCGGACCTCTGCCCCTGTCTAATCT
hide sequence
RefSeq Acc Id:
NM_001414940 ⟹ NP_001401869
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,649 - 27,366,550 (+) NCBI mRatBN7.2 7 24,313,339 - 25,479,300 (+) NCBI
RefSeq Acc Id:
XM_008765241 ⟹ XP_008763463
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,679 - 27,366,552 (+) NCBI mRatBN7.2 7 24,313,810 - 25,479,307 (+) NCBI Rnor_6.0 7 30,714,324 - 31,684,604 (+) NCBI
Sequence:
ACGCAATGAGTAATGAATACTTTAATCAAATTTAAAATCCACTTGGATGTCATCAACGAAATAGGTTATGCTTAAATCCACATCTCTATACATGTTACATTTTAATTTAAACAACTGGGTTTAGAGTT
hide sequence
RefSeq Acc Id:
XM_017594828 ⟹ XP_017450317
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,682 - 27,366,552 (+) NCBI mRatBN7.2 7 24,313,810 - 25,479,307 (+) NCBI Rnor_6.0 7 30,714,326 - 31,684,604 (+) NCBI
Sequence:
GCAATGAGTAATGAATACTTTAATCAAATTTAAAATCCACTTGGATGTCATCAACGAAATAGGT
hide sequence
RefSeq Acc Id:
XM_017594830 ⟹ XP_017450319
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,680 - 27,366,552 (+) NCBI mRatBN7.2 7 24,313,810 - 25,479,307 (+) NCBI Rnor_6.0 7 30,714,324 - 31,684,604 (+) NCBI
Sequence:
ACGCAATGAGTAATGAATACTTTAATCAAATTTAAAATCCACTTGGATGTCATCAACGAAATAGGTTATGCTTAAATCCACATCTCTATACATGTTACATTTTAATTTAAACAACTGGGTTTAGAGTT
hide sequence
RefSeq Acc Id:
XM_017594832 ⟹ XP_017450321
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,679 - 27,360,290 (+) NCBI mRatBN7.2 7 24,313,810 - 25,475,078 (+) NCBI Rnor_6.0 7 30,714,323 - 31,678,337 (+) NCBI
Sequence:
GACGCAATGAGTAATGAATACTTTAATCAAATTTAAAATCCACTTGGATGTCATCAACGAAATA
hide sequence
RefSeq Acc Id:
XM_017594833 ⟹ XP_017450322
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,679 - 27,366,552 (+) NCBI mRatBN7.2 7 24,313,810 - 25,479,307 (+) NCBI Rnor_6.0 7 30,714,323 - 31,681,176 (+) NCBI
Sequence:
GACGCAATGAGTAATGAATACTTTAATCAAATTTAAAATCCACTTGGATGTCATCAACGAAATA
hide sequence
RefSeq Acc Id:
XM_039079046 ⟹ XP_038934974
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,681 - 27,366,552 (+) NCBI mRatBN7.2 7 24,313,810 - 25,479,307 (+) NCBI
RefSeq Acc Id:
XM_039079047 ⟹ XP_038934975
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,681 - 27,366,552 (+) NCBI mRatBN7.2 7 24,313,810 - 25,479,307 (+) NCBI
RefSeq Acc Id:
XM_039079048 ⟹ XP_038934976
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,681 - 27,366,552 (+) NCBI mRatBN7.2 7 24,313,810 - 25,479,307 (+) NCBI
RefSeq Acc Id:
XM_039079050 ⟹ XP_038934978
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,677 - 27,366,552 (+) NCBI mRatBN7.2 7 24,313,810 - 25,479,307 (+) NCBI
RefSeq Acc Id:
XM_039079051 ⟹ XP_038934979
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,660 - 27,002,115 (+) NCBI mRatBN7.2 7 24,313,810 - 25,114,740 (+) NCBI
RefSeq Acc Id:
XM_063263440 ⟹ XP_063119510
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,683 - 27,366,552 (+) NCBI
RefSeq Acc Id:
XM_063263441 ⟹ XP_063119511
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,680 - 27,360,290 (+) NCBI
RefSeq Acc Id:
XM_063263442 ⟹ XP_063119512
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,200,668 - 27,332,958 (+) NCBI
RefSeq Acc Id:
XM_063263443 ⟹ XP_063119513
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 26,959,907 - 27,366,552 (+) NCBI
RefSeq Acc Id:
NP_001258300 ⟸ NM_001271371
- Peptide Label:
isoform 2
- UniProtKB:
P0C6S7 (UniProtKB/Swiss-Prot)
- Sequence:
MGKDQELLEAARTGNVALVEKLLSGRKGGILGGGSGPLPLSNLLSIWRGPNVNCTDSSGYTALHHAALNGHKDIVLKLLQFEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGPSHSRVNEQNNEN
hide sequence
RefSeq Acc Id:
XP_008763463 ⟸ XM_008765241
- Peptide Label:
isoform X10
- UniProtKB:
P0C6S7 (UniProtKB/Swiss-Prot)
- Sequence:
MIISAHPNLMSCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKVDVVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQDYLEGVGRSVVLEEEHAQEDTAQE
hide sequence
RefSeq Acc Id:
XP_017450322 ⟸ XM_017594833
- Peptide Label:
isoform X7
- UniProtKB:
P0C6S7 (UniProtKB/Swiss-Prot)
- Sequence:
MIISAHPNLMSCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKVDVVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQDYLEGVGRSVVLEEEHAQEDTAQE
hide sequence
RefSeq Acc Id:
XP_017450321 ⟸ XM_017594832
- Peptide Label:
isoform X5
- UniProtKB:
P0C6S7 (UniProtKB/Swiss-Prot)
- Sequence:
MIISAHPNLMSCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKVDVV
hide sequence
RefSeq Acc Id:
XP_017450319 ⟸ XM_017594830
- Peptide Label:
isoform X2
- UniProtKB:
P0C6S7 (UniProtKB/Swiss-Prot)
- Sequence:
MIISAHPNLMSCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKVDVVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQDYLEGVGRSVVLEEEHAQEDTAQE
hide sequence
RefSeq Acc Id:
XP_017450317 ⟸ XM_017594828
- Peptide Label:
isoform X1
- UniProtKB:
P0C6S7 (UniProtKB/Swiss-Prot)
- Sequence:
MIISAHPNLMSCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKVDVVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQDYLEGVGRSVVLEEEHAQEDTAQE
hide sequence
Ensembl Acc Id:
ENSRNOP00000056036 ⟸ ENSRNOT00000059269
RefSeq Acc Id:
XP_038934974 ⟸ XM_039079046
- Peptide Label:
isoform X3
- UniProtKB:
P0C6S7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038934975 ⟸ XM_039079047
- Peptide Label:
isoform X6
- UniProtKB:
P0C6S7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038934976 ⟸ XM_039079048
- Peptide Label:
isoform X9
- UniProtKB:
P0C6S7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038934978 ⟸ XM_039079050
- Peptide Label:
isoform X12
- UniProtKB:
P0C6S7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038934979 ⟸ XM_039079051
- Peptide Label:
isoform X13
Ensembl Acc Id:
ENSRNOP00000083101 ⟸ ENSRNOT00000113343
Ensembl Acc Id:
ENSRNOP00000083437 ⟸ ENSRNOT00000119672
Ensembl Acc Id:
ENSRNOP00000089631 ⟸ ENSRNOT00000117411
Ensembl Acc Id:
ENSRNOP00000078170 ⟸ ENSRNOT00000114777
Ensembl Acc Id:
ENSRNOP00000084534 ⟸ ENSRNOT00000102313
RefSeq Acc Id:
NP_001401869 ⟸ NM_001414940
- Peptide Label:
isoform 1
- UniProtKB:
P0C6S7 (UniProtKB/Swiss-Prot), A0A8I6GAL6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063119512 ⟸ XM_063263442
- Peptide Label:
isoform X11
- UniProtKB:
P0C6S7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063119511 ⟸ XM_063263441
- Peptide Label:
isoform X8
- UniProtKB:
P0C6S7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063119510 ⟸ XM_063263440
- Peptide Label:
isoform X4
- UniProtKB:
P0C6S7 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063119513 ⟸ XM_063263443
- Peptide Label:
isoform X14
- UniProtKB:
A0A8I5Y9Y6 (UniProtKB/TrEMBL)
BioCyc Gene G2FUF-34484 BioCyc
Ensembl Genes ENSRNOG00000024870 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000059269 ENTREZGENE
ENSRNOT00000059269.6 UniProtKB/TrEMBL
ENSRNOT00000102313 ENTREZGENE
ENSRNOT00000102313.1 UniProtKB/TrEMBL
ENSRNOT00000113343.1 UniProtKB/TrEMBL
ENSRNOT00000114777 ENTREZGENE
ENSRNOT00000114777.1 UniProtKB/TrEMBL
ENSRNOT00000117411.1 UniProtKB/TrEMBL
ENSRNOT00000119672.1 UniProtKB/Swiss-Prot
ENSRNOT00000150575 ENTREZGENE
Gene3D-CATH 1.10.150.50 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
1.25.40.20 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
2.30.29.30 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro ANKS1/Caskin UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ankyrin_rpt UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ankyrin_rpt-contain_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PH-like_dom_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PTB/PI_dom UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SAM UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SAM/pointed_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SAM_ANKS1_repeat1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SAM_ANKS1_repeat2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene 314721 ENTREZGENE
PANTHER ANKYRIN REPEAT AND STERILE ALPHA MOTIF DOMAIN-CONTAINING PROTEIN 1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PTHR24174:SF3 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam Ank_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PID UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SAM_1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Anks1b PhenoGen
PRINTS ANKYRIN UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE ANK_REP_REGION UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ANK_REPEAT UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PID UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SAM_DOMAIN UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000024870 RatGTEx
SMART ANK UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PTB UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SAM UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP PH domain-like UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SSF47769 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SSF48403 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A8I5Y9Y6 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6A7P8_RAT UniProtKB/TrEMBL
A0A8I6GAB9_RAT UniProtKB/TrEMBL
A0A8I6GAL6 ENTREZGENE, UniProtKB/TrEMBL
ANS1B_RAT UniProtKB/Swiss-Prot
F1M2J2_RAT UniProtKB/TrEMBL
P0C6S7 ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-02
Anks1b
ankyrin repeat and sterile alpha motif domain containing 1B
RGD1565556
similar to cajalin 2 isoform a
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
RGD1565556
similar to cajalin 2 isoform a
RGD1565556_predicted
similar to cajalin 2 isoform a (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-07
RGD1565556_predicted
similar to cajalin 2 isoform a (predicted)
LOC314721
similar to cajalin 2 isoform a
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC314721
similar to cajalin 2 isoform a
Symbol and Name status set to provisional
70820 PROVISIONAL
