Symbol:
Gabra3
Name:
gamma-aminobutyric acid type A receptor subunit alpha 3
RGD ID:
2648
Description:
Enables GABA-A receptor activity and ligand-gated monoatomic ion channel activity. Involved in auditory behavior; chemical synaptic transmission; and response to lead ion. Is active in GABA-ergic synapse; postsynaptic specialization membrane; and presynaptic active zone membrane. Human ortholog(s) of this gene implicated in bipolar disorder and multiple sclerosis. Orthologous to human GABRA3 (gamma-aminobutyric acid type A receptor subunit alpha3); INTERACTS WITH (S)-nicotine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
GABA(A) receptor subunit alpha-3; GABA-A receptor alpha-3 subunit; GABAAR subunit alpha-3; gamma-aminobutyric acid (GABA) A receptor, alpha 3; gamma-aminobutyric acid (GABA-A) receptor, subunit alpha 3; gamma-aminobutyric acid receptor subunit alpha-3; gamma-aminobutyric acid receptor, subunit alpha 3; gamma-aminobutyric acid type A receptor alpha3 subunit; Gamma-animobutyric acid (GABA) A receptor alpha 3; Gamma-animobutyric acid (GABA) A receptor, alpha 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 155,301,979 - 155,543,870 (-) NCBI GRCr8 mRatBN7.2 X 150,244,745 - 150,501,566 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 150,261,607 - 150,501,559 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 152,453,314 - 152,693,260 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 155,987,523 - 156,225,950 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 153,529,101 - 153,769,048 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 152,414,332 - 152,642,607 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 152,414,615 - 152,642,531 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 148,142,971 - 148,373,374 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 158,405,509 - 158,633,501 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 158,478,941 - 158,706,933 (-) NCBI Celera 1 131,236,780 - 131,471,218 (-) NCBI Celera Cytogenetic Map X q37 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gabra3 Rat (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of GABRA3 mRNA CTD PMID:28339662 Gabra3 Rat 17beta-estradiol increases expression ISO GABRA3 (Homo sapiens) 6480464 Estradiol results in increased expression of GABRA3 mRNA CTD PMID:16000229 Gabra3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gabra3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GABRA3 mRNA CTD PMID:21570461 Gabra3 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Gabra3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Gabra3 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Gabra3 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Gabra3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of GABRA3 mRNA CTD PMID:19285098 Gabra3 Rat 3-methylcholanthrene multiple interactions ISO Gabra3 (Mus musculus) 6480464 [Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of GABRA3 mRNA CTD PMID:23519560 Gabra3 Rat 4-hydroxyphenyl retinamide increases expression ISO Gabra3 (Mus musculus) 6480464 Fenretinide results in increased expression of GABRA3 mRNA CTD PMID:28973697 Gabra3 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of GABRA3 mRNA CTD PMID:24780913 Gabra3 Rat aflatoxin B1 decreases methylation ISO GABRA3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of GABRA3 gene CTD PMID:27153756 Gabra3 Rat Aflatoxin B2 alpha increases methylation ISO GABRA3 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of GABRA3 intron CTD PMID:30157460 Gabra3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GABRA3 mRNA CTD PMID:16483693 Gabra3 Rat antirheumatic drug decreases expression ISO GABRA3 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of GABRA3 mRNA CTD PMID:24449571 Gabra3 Rat arsenite(3-) multiple interactions ISO GABRA3 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to GABRA3 mRNA] CTD PMID:32406909 Gabra3 Rat benzo[a]pyrene affects methylation ISO GABRA3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GABRA3 5' UTR more ... CTD PMID:27901495 and PMID:30157460 Gabra3 Rat benzo[e]pyrene increases methylation ISO GABRA3 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of GABRA3 exon and benzo(e)pyrene results in increased methylation of GABRA3 intron CTD PMID:30157460 Gabra3 Rat Benzo[ghi]perylene increases expression ISO Gabra3 (Mus musculus) 6480464 1 and 12-benzoperylene results in increased expression of GABRA3 mRNA CTD PMID:26377693 Gabra3 Rat Benzo[k]fluoranthene decreases expression ISO Gabra3 (Mus musculus) 6480464 benzo(k)fluoranthene results in decreased expression of GABRA3 mRNA CTD PMID:26377693 Gabra3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GABRA3 mRNA CTD PMID:26950200 Gabra3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of GABRA3 gene CTD PMID:28505145 Gabra3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GABRA3 mRNA CTD PMID:30816183 and PMID:34947998 Gabra3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GABRA3 mRNA CTD PMID:25181051 Gabra3 Rat bisphenol F increases expression ISO Gabra3 (Mus musculus) 6480464 bisphenol F results in increased expression of GABRA3 mRNA CTD PMID:38685157 Gabra3 Rat CGP 52608 multiple interactions ISO GABRA3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GABRA3 gene] CTD PMID:28238834 Gabra3 Rat chrysene increases expression ISO Gabra3 (Mus musculus) 6480464 chrysene results in increased expression of GABRA3 mRNA CTD PMID:26377693 Gabra3 Rat crocidolite asbestos increases expression ISO Gabra3 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of GABRA3 mRNA CTD PMID:19446018 Gabra3 Rat diazepam decreases expression EXP 6480464 Diazepam results in decreased expression of GABRA3 mRNA CTD PMID:15802192 Gabra3 Rat diazepam multiple interactions EXP 6480464 Diazepam inhibits the reaction [Ethanol deficiency results in increased expression of GABRA3 mRNA] CTD PMID:14684873 Gabra3 Rat diazepam increases activity EXP 6480464 Diazepam results in increased activity of GABRA3 protein CTD PMID:15613639 Gabra3 Rat diquat decreases expression ISO Gabra3 (Mus musculus) 6480464 Diquat results in decreased expression of GABRA3 mRNA CTD PMID:36851058 Gabra3 Rat ethanol multiple interactions EXP 6480464 Diazepam inhibits the reaction [Ethanol deficiency results in increased expression of GABRA3 mRNA] CTD PMID:14684873 Gabra3 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of GABRA3 mRNA CTD PMID:14684873 Gabra3 Rat ethanol increases expression EXP 6480464 Ethanol deficiency results in increased expression of GABRA3 mRNA CTD PMID:14684873 Gabra3 Rat ethylparaben decreases expression ISO GABRA3 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of GABRA3 mRNA CTD PMID:37690743 Gabra3 Rat Etizolam affects expression EXP 6480464 etizolam affects the expression of GABRA3 mRNA CTD PMID:16107249 Gabra3 Rat famotidine multiple interactions EXP 6480464 Famotidine inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA3 protein binds to GABRB2 protein binds to GABRG1 protein]] and Famotidine inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA3 protein binds to GABRB2 protein binds to GABRG2 protein]] CTD PMID:15363660 Gabra3 Rat gamma-aminobutyric acid multiple interactions EXP 6480464 Famotidine inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of [GABRA3 protein binds to GABRB2 protein binds to GABRG1 protein]] more ... CTD PMID:15363660 Gabra3 Rat genistein increases expression ISO Gabra3 (Mus musculus) 6480464 Genistein results in increased expression of GABRA3 mRNA CTD PMID:32186404 Gabra3 Rat inulin multiple interactions ISO Gabra3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of GABRA3 mRNA CTD PMID:36331819 Gabra3 Rat Lorazepam increases expression EXP 6480464 Lorazepam results in increased expression of GABRA3 mRNA CTD PMID:16107249 Gabra3 Rat methapyrilene increases methylation ISO GABRA3 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of GABRA3 exon and Methapyrilene results in increased methylation of GABRA3 intron CTD PMID:30157460 Gabra3 Rat N-nitrosodiethylamine multiple interactions ISO Gabra3 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of GABRA3 mRNA CTD PMID:24535843 Gabra3 Rat nicotine increases expression EXP 6480464 Nicotine results in increased expression of GABRA3 mRNA CTD PMID:28339662 Gabra3 Rat ozone multiple interactions ISO Gabra3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of GABRA3 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of GABRA3 mRNA CTD PMID:27106289 and PMID:34911549 Gabra3 Rat paracetamol increases expression ISO GABRA3 (Homo sapiens) 6480464 Acetaminophen results in increased expression of GABRA3 mRNA CTD PMID:29067470 Gabra3 Rat paracetamol affects response to substance ISO Gabra3 (Mus musculus) 6480464 GABRA3 mRNA affects the susceptibility to Acetaminophen CTD PMID:27530116 Gabra3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Gabra3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of GABRA3 mRNA CTD PMID:36331819 Gabra3 Rat phenobarbital multiple interactions ISO Gabra3 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased expression of GABRA3 mRNA CTD PMID:24535843 Gabra3 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Gabra3 (Mus musculus) 6480464 [Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of GABRA3 mRNA CTD PMID:23519560 Gabra3 Rat pioglitazone multiple interactions ISO Gabra3 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of GABRA3 mRNA CTD PMID:27935865 Gabra3 Rat razoxane decreases expression EXP 6480464 Razoxane results in decreased expression of GABRA3 mRNA CTD PMID:19915844 Gabra3 Rat sodium arsenite decreases expression ISO GABRA3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GABRA3 mRNA CTD PMID:35954277 Gabra3 Rat tetrachloromethane affects expression ISO Gabra3 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of GABRA3 mRNA CTD PMID:17484886 Gabra3 Rat titanium dioxide increases expression ISO Gabra3 (Mus musculus) 6480464 titanium dioxide results in increased expression of GABRA3 mRNA CTD PMID:23557971 Gabra3 Rat valproic acid decreases methylation ISO GABRA3 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of GABRA3 gene CTD PMID:29154799 Gabra3 Rat valproic acid affects expression ISO Gabra3 (Mus musculus) 6480464 Valproic Acid affects the expression of GABRA3 mRNA CTD PMID:17963808
(S)-nicotine (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-methylcholanthrene (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) Benzo[ghi]perylene (ISO) Benzo[k]fluoranthene (ISO) bisphenol A (EXP) bisphenol F (ISO) CGP 52608 (ISO) chrysene (ISO) crocidolite asbestos (ISO) diazepam (EXP) diquat (ISO) ethanol (EXP) ethylparaben (ISO) Etizolam (EXP) famotidine (EXP) gamma-aminobutyric acid (EXP) genistein (ISO) inulin (ISO) Lorazepam (EXP) methapyrilene (ISO) N-nitrosodiethylamine (ISO) nicotine (EXP) ozone (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phorbol 13-acetate 12-myristate (ISO) pioglitazone (ISO) razoxane (EXP) sodium arsenite (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) valproic acid (ISO)
Molecular Function
benzodiazepine receptor activity (IBA) chloride channel activity (IBA) GABA-A receptor activity (IDA,IEA,ISO,TAS) GABA-gated chloride ion channel activity (IBA,IDA,IEA,ISO,ISS) ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential (IDA,IMP,NAS) protein binding (IPI,ISO) transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential (EXP,IDA,ISO)
1.
Presynaptic and postsynaptic GABAA receptors in rat suprachiasmatic nucleus.
Belenky MA, etal., Neuroscience. 2003;118(4):909-23.
2.
Neonatal development of the rat visual cortex: synaptic function of GABAA receptor alpha subunits.
Bosman LW, etal., J Physiol 2002 Nov 15;545(Pt 1):169-81.
3.
Setting the time course of inhibitory synaptic currents by mixing multiple GABA(A) receptor a subunit isoforms.
Eyre MD, etal., J Neurosci. 2012 Apr 25;32(17):5853-67. doi: 10.1523/JNEUROSCI.6495-11.2012.
4.
Association between the gamma-aminobutyric acid A3 receptor gene and multiple sclerosis.
Gade-Andavolu R, etal., Arch Neurol 1998 Apr;55(4):513-6.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Auditory Training Reverses Lead (Pb)-Toxicity-Induced Changes in Sound-Azimuth Selectivity of Cortical Neurons.
Liu X, etal., Cereb Cortex. 2019 Jul 22;29(8):3294-3304. doi: 10.1093/cercor/bhy199.
8.
Functional expression and sites of gene transcription of a novel alpha subunit of the GABAA receptor in rat brain.
Malherbe P, etal., FEBS Lett 1990 Jan 29;260(2):261-5.
9.
Excess of allele1 for alpha3 subunit GABA receptor gene (GABRA3) in bipolar patients: a multicentric association study.
Massat I, etal., Mol Psychiatry 2002;7(2):201-7.
10.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
Spontaneous and gamma-aminobutyric acid (GABA)-activated GABA(A) receptor channels formed by epsilon subunit-containing isoforms.
Neelands TR, etal., Mol Pharmacol. 1999 Jan;55(1):168-78. doi: 10.1124/mol.55.1.168.
13.
GOA pipeline
RGD automated data pipeline
14.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Gamma-aminobutyric acid receptor (GABA(A)) subunits in rat nucleus tractus solitarii (NTS) revealed by polymerase chain reaction (PCR) and immunohistochemistry.PG - 241-57
Saha S, etal., Mol Cell Neurosci 2001 Jan;17(1):241-57.
17.
Ethanol concentration-dependent alterations in gene expression during acute binge drinking in the HIV-1 transgenic rat.
Sarkar S and Chang SL, Alcohol Clin Exp Res. 2013 Jul;37(7):1082-90. doi: 10.1111/acer.12077. Epub 2013 Feb 15.
18.
Molecular basis of the gamma-aminobutyric acid A receptor alpha3 subunit interaction with the clustering protein gephyrin.
Tretter V, etal., J Biol Chem. 2011 Oct 28;286(43):37702-11. doi: 10.1074/jbc.M111.291336. Epub 2011 Aug 31.
Gabra3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 155,301,979 - 155,543,870 (-) NCBI GRCr8 mRatBN7.2 X 150,244,745 - 150,501,566 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 150,261,607 - 150,501,559 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 152,453,314 - 152,693,260 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 155,987,523 - 156,225,950 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 153,529,101 - 153,769,048 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 152,414,332 - 152,642,607 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 152,414,615 - 152,642,531 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 148,142,971 - 148,373,374 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 158,405,509 - 158,633,501 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 158,478,941 - 158,706,933 (-) NCBI Celera 1 131,236,780 - 131,471,218 (-) NCBI Celera Cytogenetic Map X q37 NCBI
GABRA3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 152,166,234 - 152,451,315 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 152,166,234 - 152,451,315 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 151,334,706 - 151,619,787 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 151,086,290 - 151,370,487 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 151,007,096 - 151,290,398 NCBI Celera X 151,581,116 - 151,866,622 (-) NCBI Celera Cytogenetic Map X q28 NCBI HuRef X 140,189,381 - 140,473,318 (-) NCBI HuRef CHM1_1 X 151,210,380 - 151,494,516 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 150,432,298 - 150,717,938 (-) NCBI T2T-CHM13v2.0
Gabra3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 71,476,282 - 71,700,525 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 71,476,287 - 71,700,454 (-) Ensembl GRCm39 Ensembl GRCm38 X 72,432,676 - 72,656,919 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 72,432,681 - 72,656,848 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 69,678,015 - 69,901,585 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 68,686,537 - 68,908,906 (-) NCBI MGSCv36 mm8 Celera X 63,400,804 - 63,600,363 (-) NCBI Celera Cytogenetic Map X A7.3 NCBI cM Map X 37.24 NCBI
Gabra3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955498 7,672,943 - 7,904,369 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955498 7,672,982 - 7,904,783 (-) NCBI ChiLan1.0 ChiLan1.0
GABRA3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 152,229,775 - 152,490,867 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 152,233,378 - 152,494,460 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 141,739,962 - 142,001,041 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 151,697,537 - 151,956,879 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 151,697,537 - 151,878,484 (-) Ensembl panpan1.1 panPan2
GABRA3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 120,152,650 - 120,460,604 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 120,153,261 - 120,460,119 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 105,530,627 - 105,839,355 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 122,414,804 - 122,682,830 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 122,425,056 - 122,682,333 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 119,092,886 - 119,401,752 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 121,583,594 - 121,892,563 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 121,458,330 - 121,767,417 (-) NCBI UU_Cfam_GSD_1.0
Gabra3
GABRA3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 123,456,947 - 123,684,790 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 123,456,952 - 123,684,814 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 141,020,707 - 141,147,922 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GABRA3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 126,735,146 - 126,999,990 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 126,735,288 - 127,000,017 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666065 64,572,635 - 64,862,527 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gabra3
.
Predicted Target Of
Count of predictions: 40 Count of miRNA genes: 34 Interacting mature miRNAs: 39 Transcripts: ENSRNOT00000040729 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
738025 Stresp3 Stress response QTL 3 4.61 0.0066 stress-related behavior trait (VT:0010451) defensive burying - approach X 105359969 157758123 Rat 10059603 Bw174 Body weight QTL 174 3.4 0.025 body mass (VT:0001259) body weight (CMO:0000012) X 118973754 157758123 Rat
DXWox31
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 150,255,946 - 150,256,146 (+) MAPPER mRatBN7.2 Rnor_6.0 X 152,409,606 - 152,409,805 NCBI Rnor6.0 Rnor_5.0 1 148,137,728 - 148,137,927 UniSTS Rnor5.0 Celera 1 131,231,127 - 131,231,326 UniSTS Cytogenetic Map X q37 UniSTS
AU048027
Rat Assembly Chr Position (strand) Source JBrowse Celera 1 131,306,251 - 131,306,529 UniSTS Cytogenetic Map X q37 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
6
47
113
48
45
21
15
21
6
138
81
93
21
59
24
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000080277 ⟹ ENSRNOP00000075419
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl X 152,414,615 - 152,641,679 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000085037 ⟹ ENSRNOP00000070043
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 150,261,607 - 150,501,559 (-) Ensembl Rnor_6.0 Ensembl X 152,415,134 - 152,642,531 (-) Ensembl
RefSeq Acc Id:
NM_017069 ⟹ NP_058765
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 155,303,928 - 155,543,870 (-) NCBI mRatBN7.2 X 150,261,607 - 150,501,566 (-) NCBI Rnor_6.0 X 152,415,134 - 152,642,538 (-) NCBI Rnor_5.0 1 148,142,971 - 148,373,374 (-) NCBI RGSC_v3.4 X 158,405,509 - 158,633,501 (-) RGD Celera 1 131,236,780 - 131,471,218 (-) NCBI
Sequence:
CTTTTTTGATGTACAGTTTTTAGGAGCTCATTATTATCCTTGGAGATGGAACGCGAGCAGACAAGATTGTCAAACCTTTATTTGGAGCCTGGGTTAGAAGGCACGCCCATAGAGATGGAAGGGAGAAA
hide sequence
RefSeq Acc Id:
XM_017601916 ⟹ XP_017457405
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 155,301,979 - 155,543,276 (-) NCBI mRatBN7.2 X 150,244,745 - 150,500,968 (-) NCBI Rnor_6.0 X 152,414,332 - 152,641,700 (-) NCBI
Sequence:
GAGAGAGAGAGAGAGAGAGAGAGAGAAAGGGAGGAAGCGAGGGAGGAAGAGAAGAGGGGAAGAGCGTGAGCGCGCGCTAGCTAGCTAGCAAAGCAGAGAGAAAGACTGAGATAGGGACTAGGAGAGAC
hide sequence
RefSeq Acc Id:
NP_058765 ⟸ NM_017069
- Peptide Label:
precursor
- UniProtKB:
P20236 (UniProtKB/Swiss-Prot), F1LNZ5 (UniProtKB/TrEMBL), A0A8L2UPR9 (UniProtKB/TrEMBL)
- Sequence:
MITTQMWHFYVTRVGLLLLISILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLK
hide sequence
RefSeq Acc Id:
XP_017457405 ⟸ XM_017601916
- Peptide Label:
isoform X1
- UniProtKB:
P20236 (UniProtKB/Swiss-Prot), F1LNZ5 (UniProtKB/TrEMBL), A0A8L2UPR9 (UniProtKB/TrEMBL)
- Sequence:
MITTQMWHFYVTRVGLLLLISILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLK
hide sequence
Ensembl Acc Id:
ENSRNOP00000075419 ⟸ ENSRNOT00000080277
Ensembl Acc Id:
ENSRNOP00000070043 ⟸ ENSRNOT00000085037
RGD ID: 13702029 Promoter ID: EPDNEW_R12550 Type: multiple initiation site Name: Gabra3_1 Description: gamma-aminobutyric acid type A receptor alpha3 subunit SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 152,641,640 - 152,641,700 EPDNEW
BioCyc Gene G2FUF-704 BioCyc
Ensembl Genes ENSRNOG00000056558 Ensembl, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000085037.2 UniProtKB/TrEMBL
Gene3D-CATH 1.20.58.390 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
2.70.170.10 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro GABAA/Glycine_rcpt UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GABAAa_rcpt UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GABBAa3_rcpt UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Gabra-1-6_TM UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Neur_chan_lig-bd UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Neur_chan_lig-bd_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Neur_channel UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Neuro-gated_channel_TM_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Neuro_actylchol_rec UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Neurotrans-gated_channel_TM UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Neurotransmitter_ion_chnl_CS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:24947 UniProtKB/Swiss-Prot
NCBI Gene 24947 ENTREZGENE
PANTHER PTHR18945 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam Neur_chan_LBD UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Neur_chan_memb UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Gabra3 PhenoGen
PRINTS GABAARALPHA UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GABAARALPHA3 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GABAARECEPTR UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NRIONCHANNEL UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE NEUROTR_ION_CHANNEL UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000056558 RatGTEx
Superfamily-SCOP SSF63712 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SSF90112 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A8L2UPR9 ENTREZGENE, UniProtKB/TrEMBL
A6KSY0_RAT UniProtKB/TrEMBL
F1LNZ5 ENTREZGENE
GBRA3_RAT UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary F1LNZ5 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-12-06
Gabra3
gamma-aminobutyric acid type A receptor subunit alpha 3
Gabra3
gamma-aminobutyric acid type A receptor alpha3 subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-02-11
Gabra3
gamma-aminobutyric acid type A receptor alpha3 subunit
Gabra3
gamma-aminobutyric acid (GABA) A receptor, alpha 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-04
Gabra3
gamma-aminobutyric acid (GABA) A receptor, alpha 3
Gabra3
gamma-aminobutyric acid (GABA-A) receptor, subunit alpha 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Gabra3
gamma-aminobutyric acid (GABA-A) receptor, subunit alpha 3
Gabra3
gamma-aminobutyric acid receptor, subunit alpha 3
Name updated
1299863 APPROVED
2002-11-06
Gabra3
gamma-aminobutyric acid receptor, subunit alpha 3
Gabra3
Gamma-animobutyric acid (GABA) A receptor, alpha 3
Name updated
625702 APPROVED
Note Type
Note
Reference
gene_cellular_localization
localizes to both cytoplasmic and subsynaptic sites of NTS neurons
625528
gene_expression
relatively high expression in NTS
625528
gene_expression
protein expression seen throughout the dorsal vagal complex and other areas of medulla (gracile, cuneate, spinal tirgeminal, olivary and reticular nuclei) with higher expression seen in hypoglossal motoneurons
625528
gene_process
may mediate inhibitory GABA responses in nucleus tractus solitarii (NTS) in the brain
625528
