Symbol:
Slc16a7
Name:
solute carrier family 16 member 7
RGD ID:
3691
Description:
Enables symporter activity. Involved in plasma membrane lactate transport. Is active in several cellular components, including Schaffer collateral - CA1 synapse; hippocampal mossy fiber to CA3 synapse; and parallel fiber to Purkinje cell synapse. Orthologous to human SLC16A7 (solute carrier family 16 member 7); INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MCT 2; Mct2; MGC93092; monocarboxylate transporter 2; solute carrier family 16 (monocarboxylate transporter), member 7; solute carrier family 16 (monocarboxylic acid transporters) member 7; solute carrier family 16 (monocarboxylic acid transporters), member 7; solute carrier family 16, member 7; solute carrier family 16, member 7 (monocarboxylic acid transporter 2)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 62,929,067 - 63,096,995 (-) NCBI GRCr8 mRatBN7.2 7 61,043,667 - 61,211,547 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 61,051,167 - 61,154,994 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 62,936,997 - 63,040,542 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 65,139,665 - 65,243,207 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 64,915,969 - 65,019,570 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 68,438,341 - 68,606,312 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 68,446,193 - 68,549,763 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 68,633,417 - 68,801,189 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 65,210,148 - 65,313,572 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 65,230,721 - 65,390,741 (-) NCBI Celera 7 58,206,868 - 58,309,915 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc16a7 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of SLC16A7 mRNA] CTD PMID:31150632 Slc16a7 Rat (1->4)-beta-D-glucan multiple interactions ISO Slc16a7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SLC16A7 mRNA CTD PMID:36331819 Slc16a7 Rat 1,1-dichloroethene decreases expression ISO Slc16a7 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of SLC16A7 mRNA CTD PMID:26682919 Slc16a7 Rat 1,2-dimethylhydrazine decreases expression ISO Slc16a7 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SLC16A7 mRNA CTD PMID:22206623 Slc16a7 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of SLC16A7 mRNA CTD PMID:29097150 Slc16a7 Rat 17beta-estradiol multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [Estradiol co-treated with Norethindrone Acetate] results in decreased expression of SLC16A7 mRNA more ... CTD PMID:19619570 more ... Slc16a7 Rat 17beta-estradiol affects expression ISO Slc16a7 (Mus musculus) 6480464 Estradiol affects the expression of SLC16A7 mRNA CTD PMID:39298647 Slc16a7 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of SLC16A7 mRNA CTD PMID:32145629 Slc16a7 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of SLC16A7 mRNA CTD PMID:26496021 Slc16a7 Rat 17beta-estradiol increases expression ISO SLC16A7 (Homo sapiens) 6480464 Estradiol results in increased expression of SLC16A7 mRNA CTD PMID:19619570 Slc16a7 Rat 17beta-estradiol 3-benzoate increases methylation EXP 6480464 estradiol 3-benzoate results in increased methylation of SLC16A7 promoter CTD PMID:27415467 Slc16a7 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Slc16a7 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Slc16a7 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Slc16a7 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Slc16a7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of SLC16A7 mRNA CTD PMID:19619570 Slc16a7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Slc16a7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to SLC16A7 gene] CTD PMID:28213091 Slc16a7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Slc16a7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC16A7 mRNA CTD PMID:28922406 Slc16a7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO SLC16A7 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC16A7 mRNA CTD PMID:19619570 more ... Slc16a7 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SLC16A7 mRNA CTD PMID:21215274 and PMID:32109520 Slc16a7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO SLC16A7 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of SLC16A7 mRNA CTD PMID:22298810 Slc16a7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Slc16a7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SLC16A7 mRNA CTD PMID:20702594 and PMID:28213091 Slc16a7 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Slc16a7 (Mus musculus) 6480464 2 more ... CTD PMID:20702594 Slc16a7 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Slc16a7 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO SLC16A7 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Slc16a7 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of SLC16A7 mRNA CTD PMID:21346803 Slc16a7 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of SLC16A7 mRNA CTD PMID:28522335 Slc16a7 Rat 3-iodothyronamine affects uptake ISO SLC16A7 (Homo sapiens) 6480464 SLC16A7 mRNA affects the uptake of 3-iodothyronamine CTD PMID:19074582 Slc16a7 Rat 4,4'-sulfonyldiphenol decreases expression ISO Slc16a7 (Mus musculus) 6480464 bisphenol S results in decreased expression of SLC16A7 mRNA CTD PMID:39298647 Slc16a7 Rat 4,4'-sulfonyldiphenol increases expression ISO SLC16A7 (Homo sapiens) 6480464 bisphenol S results in increased expression of SLC16A7 protein CTD PMID:34186270 Slc16a7 Rat 4-hydroxyphenyl retinamide decreases expression ISO Slc16a7 (Mus musculus) 6480464 Fenretinide results in decreased expression of SLC16A7 mRNA CTD PMID:28973697 Slc16a7 Rat acrolein multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of SLC16A7 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of SLC16A7 mRNA CTD PMID:32699268 Slc16a7 Rat aflatoxin B1 decreases expression ISO Slc16a7 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of SLC16A7 mRNA CTD PMID:19770486 Slc16a7 Rat aflatoxin B1 increases methylation ISO SLC16A7 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of SLC16A7 intron CTD PMID:30157460 Slc16a7 Rat all-trans-retinoic acid increases expression ISO SLC16A7 (Homo sapiens) 6480464 Tretinoin results in increased expression of SLC16A7 mRNA CTD PMID:21934132 Slc16a7 Rat all-trans-retinoic acid decreases expression ISO SLC16A7 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SLC16A7 mRNA CTD PMID:33167477 Slc16a7 Rat all-trans-retinoic acid affects expression ISO SLC16A7 (Homo sapiens) 6480464 Tretinoin affects the expression of SLC16A7 mRNA CTD PMID:15498508 Slc16a7 Rat alpha-pinene multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of SLC16A7 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of SLC16A7 mRNA CTD PMID:32699268 Slc16a7 Rat amiodarone increases expression ISO Slc16a7 (Mus musculus) 6480464 Amiodarone results in increased expression of SLC16A7 mRNA CTD PMID:24535564 Slc16a7 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SLC16A7 mRNA CTD PMID:16483693 Slc16a7 Rat aristolochic acid A decreases expression ISO SLC16A7 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SLC16A7 mRNA CTD PMID:33212167 Slc16a7 Rat arsane multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SLC16A7 mRNA CTD PMID:39836092 Slc16a7 Rat arsenic atom multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SLC16A7 mRNA CTD PMID:39836092 Slc16a7 Rat benzo[a]pyrene affects methylation ISO SLC16A7 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SLC16A7 intron CTD PMID:30157460 Slc16a7 Rat benzo[a]pyrene diol epoxide I decreases expression ISO SLC16A7 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Slc16a7 Rat bis(2-chloroethyl) sulfide affects expression EXP 6480464 Mustard Gas affects the expression of SLC16A7 mRNA CTD PMID:15651846 Slc16a7 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of SLC16A7 mRNA CTD PMID:26496021 Slc16a7 Rat bisphenol A increases expression ISO SLC16A7 (Homo sapiens) 6480464 bisphenol A results in increased expression of SLC16A7 protein CTD PMID:34186270 Slc16a7 Rat bisphenol A increases methylation ISO SLC16A7 (Homo sapiens) 6480464 bisphenol A results in increased methylation of SLC16A7 gene CTD PMID:31601247 Slc16a7 Rat bisphenol A increases expression ISO Slc16a7 (Mus musculus) 6480464 bisphenol A results in increased expression of SLC16A7 mRNA CTD PMID:38701888 Slc16a7 Rat bisphenol A decreases methylation ISO Slc16a7 (Mus musculus) 6480464 bisphenol A results in decreased methylation of SLC16A7 promoter CTD PMID:27312807 Slc16a7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SLC16A7 mRNA CTD PMID:29097150 and PMID:32145629 Slc16a7 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SLC16A7 gene CTD PMID:28505145 Slc16a7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLC16A7 mRNA CTD PMID:25181051 more ... Slc16a7 Rat bisphenol AF increases expression ISO SLC16A7 (Homo sapiens) 6480464 bisphenol AF results in increased expression of SLC16A7 protein CTD PMID:34186270 Slc16a7 Rat Bisphenol B increases expression ISO SLC16A7 (Homo sapiens) 6480464 bisphenol B results in increased expression of SLC16A7 protein CTD PMID:34186270 Slc16a7 Rat bisphenol F increases expression ISO SLC16A7 (Homo sapiens) 6480464 bisphenol F results in increased expression of SLC16A7 protein CTD PMID:34186270 Slc16a7 Rat chlordecone decreases expression ISO Slc16a7 (Mus musculus) 6480464 Chlordecone results in decreased expression of SLC16A7 mRNA CTD PMID:33711761 Slc16a7 Rat chlorpyrifos decreases expression ISO Slc16a7 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of SLC16A7 mRNA CTD PMID:37019170 Slc16a7 Rat ciguatoxin CTX1B affects expression ISO Slc16a7 (Mus musculus) 6480464 Ciguatoxins affects the expression of SLC16A7 mRNA CTD PMID:18353800 Slc16a7 Rat cisplatin multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of SLC16A7 mRNA CTD PMID:27392435 Slc16a7 Rat cisplatin decreases expression ISO SLC16A7 (Homo sapiens) 6480464 Cisplatin results in decreased expression of SLC16A7 mRNA CTD PMID:27392435 Slc16a7 Rat copper(II) sulfate decreases expression ISO SLC16A7 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SLC16A7 mRNA CTD PMID:19549813 Slc16a7 Rat coumarin increases phosphorylation ISO SLC16A7 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of SLC16A7 protein CTD PMID:35688186 Slc16a7 Rat crocidolite asbestos decreases expression ISO Slc16a7 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of SLC16A7 mRNA CTD PMID:29279043 Slc16a7 Rat dibenz[a,h]anthracene increases expression ISO Slc16a7 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Slc16a7 Rat dieldrin decreases expression EXP 6480464 Dieldrin results in decreased expression of SLC16A7 mRNA CTD PMID:23153324 Slc16a7 Rat dorsomorphin multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Slc16a7 Rat doxorubicin decreases expression ISO SLC16A7 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SLC16A7 mRNA CTD PMID:29803840 Slc16a7 Rat epoxiconazole increases expression ISO Slc16a7 (Mus musculus) 6480464 epoxiconazole results in increased expression of SLC16A7 mRNA CTD PMID:35436446 Slc16a7 Rat ethanol increases expression ISO Slc16a7 (Mus musculus) 6480464 Ethanol results in increased expression of SLC16A7 mRNA CTD PMID:19167417 Slc16a7 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of SLC16A7 mRNA CTD PMID:24136188 Slc16a7 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of SLC16A7 mRNA CTD PMID:18035473 Slc16a7 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of SLC16A7 mRNA CTD PMID:24136188 Slc16a7 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of SLC16A7 mRNA CTD PMID:24793618 Slc16a7 Rat formaldehyde decreases expression ISO SLC16A7 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SLC16A7 mRNA CTD PMID:27664576 Slc16a7 Rat geldanamycin increases expression ISO SLC16A7 (Homo sapiens) 6480464 geldanamycin results in increased expression of SLC16A7 mRNA CTD PMID:26705709 Slc16a7 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of SLC16A7 mRNA CTD PMID:24136188 Slc16a7 Rat heptachlor decreases expression EXP 6480464 Heptachlor results in decreased expression of SLC16A7 mRNA CTD PMID:23153324 Slc16a7 Rat hydrogen peroxide decreases response to substance ISO Slc16a7 (Mus musculus) 6480464 SLC16A7 protein results in decreased susceptibility to Hydrogen Peroxide CTD PMID:16766717 Slc16a7 Rat inulin multiple interactions ISO Slc16a7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SLC16A7 mRNA CTD PMID:36331819 Slc16a7 Rat isotretinoin decreases expression ISO SLC16A7 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of SLC16A7 mRNA CTD PMID:20436886 Slc16a7 Rat lanthanum trichloride decreases expression EXP 6480464 lanthanum chloride results in decreased expression of SLC16A7 mRNA and lanthanum chloride results in decreased expression of SLC16A7 protein CTD PMID:29264619 Slc16a7 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of SLC16A7 mRNA CTD PMID:24136188 Slc16a7 Rat Licochalcone B decreases expression ISO SLC16A7 (Homo sapiens) 6480464 licochalcone B results in decreased expression of SLC16A7 mRNA CTD PMID:33647349 Slc16a7 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of SLC16A7 mRNA CTD PMID:30467583 Slc16a7 Rat methidathion decreases expression ISO Slc16a7 (Mus musculus) 6480464 methidathion results in decreased expression of SLC16A7 mRNA CTD PMID:34813904 Slc16a7 Rat methylseleninic acid increases expression ISO SLC16A7 (Homo sapiens) 6480464 methylselenic acid results in increased expression of SLC16A7 mRNA CTD PMID:18548127 Slc16a7 Rat mirex decreases expression EXP 6480464 Mirex results in decreased expression of SLC16A7 mRNA CTD PMID:23153324 Slc16a7 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of SLC16A7 mRNA CTD PMID:24136188 Slc16a7 Rat ozone multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of SLC16A7 mRNA more ... CTD PMID:32699268 Slc16a7 Rat p-chloromercuribenzoic acid decreases expression ISO SLC16A7 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of SLC16A7 mRNA CTD PMID:26272509 Slc16a7 Rat p-chloromercuribenzoic acid multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SLC16A7 mRNA CTD PMID:27188386 Slc16a7 Rat paracetamol affects expression ISO Slc16a7 (Mus musculus) 6480464 Acetaminophen affects the expression of SLC16A7 mRNA CTD PMID:17562736 Slc16a7 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SLC16A7 mRNA CTD PMID:33387578 Slc16a7 Rat paracetamol increases expression ISO SLC16A7 (Homo sapiens) 6480464 Acetaminophen results in increased expression of SLC16A7 mRNA CTD PMID:26690555 Slc16a7 Rat paracetamol decreases expression ISO SLC16A7 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of SLC16A7 mRNA CTD PMID:21420995 and PMID:29067470 Slc16a7 Rat PCB138 multiple interactions ISO Slc16a7 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Slc16a7 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Slc16a7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SLC16A7 mRNA more ... CTD PMID:36331819 Slc16a7 Rat phenobarbital multiple interactions ISO Slc16a7 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of SLC16A7 mRNA] CTD PMID:19482888 Slc16a7 Rat phenobarbital increases expression ISO Slc16a7 (Mus musculus) 6480464 Phenobarbital results in increased expression of SLC16A7 mRNA CTD PMID:19270015 and PMID:19482888 Slc16a7 Rat phenylephrine decreases expression EXP 6480464 Phenylephrine results in decreased expression of SLC16A7 mRNA CTD PMID:18158353 Slc16a7 Rat phenylmercury acetate increases expression ISO SLC16A7 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of SLC16A7 mRNA CTD PMID:26272509 Slc16a7 Rat phenylmercury acetate multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC16A7 mRNA CTD PMID:27188386 Slc16a7 Rat pirinixic acid multiple interactions ISO Slc16a7 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of SLC16A7 mRNA and PPARA protein promotes the reaction [pirinixic acid results in increased expression of SLC16A7 mRNA] CTD PMID:19710929 and PMID:20059764 Slc16a7 Rat pirinixic acid increases expression ISO Slc16a7 (Mus musculus) 6480464 pirinixic acid results in increased expression of SLC16A7 mRNA CTD PMID:18301758 more ... Slc16a7 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of SLC16A7 mRNA CTD PMID:19162173 Slc16a7 Rat progesterone decreases expression ISO SLC16A7 (Homo sapiens) 6480464 Progesterone results in decreased expression of SLC16A7 mRNA CTD PMID:21795739 Slc16a7 Rat resveratrol multiple interactions ISO Slc16a7 (Mus musculus) 6480464 Resveratrol inhibits the reaction [titanium dioxide results in increased expression of SLC16A7 mRNA] CTD PMID:31298478 Slc16a7 Rat SB 431542 multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Slc16a7 Rat silicon dioxide decreases expression ISO SLC16A7 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of SLC16A7 mRNA and Silicon Dioxide results in decreased expression of SLC16A7 mRNA CTD PMID:22300531 more ... Slc16a7 Rat silicon dioxide decreases expression ISO Slc16a7 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of SLC16A7 mRNA CTD PMID:19073995 Slc16a7 Rat sodium arsenite decreases expression ISO SLC16A7 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SLC16A7 mRNA CTD PMID:38568856 Slc16a7 Rat sodium arsenite multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of SLC16A7 mRNA CTD PMID:39836092 Slc16a7 Rat tamibarotene affects expression ISO SLC16A7 (Homo sapiens) 6480464 tamibarotene affects the expression of SLC16A7 mRNA CTD PMID:15498508 Slc16a7 Rat testosterone enanthate affects expression ISO SLC16A7 (Homo sapiens) 6480464 testosterone enanthate affects the expression of SLC16A7 mRNA CTD PMID:17440010 Slc16a7 Rat tetrachloroethene increases expression ISO Slc16a7 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of SLC16A7 mRNA CTD PMID:28973375 Slc16a7 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of SLC16A7 mRNA] CTD PMID:31150632 Slc16a7 Rat tetrachloromethane decreases expression ISO Slc16a7 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of SLC16A7 mRNA CTD PMID:31919559 Slc16a7 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of SLC16A7 mRNA CTD PMID:31150632 Slc16a7 Rat tetracycline decreases expression ISO Slc16a7 (Mus musculus) 6480464 Tetracycline results in decreased expression of SLC16A7 mRNA CTD PMID:24489787 Slc16a7 Rat thallium multiple interactions EXP 6480464 [thallium sulfate results in increased abundance of Thallium] which results in decreased expression of SLC16A7 mRNA CTD PMID:39361050 Slc16a7 Rat thallium sulfate multiple interactions EXP 6480464 [thallium sulfate results in increased abundance of Thallium] which results in decreased expression of SLC16A7 mRNA CTD PMID:39361050 Slc16a7 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of SLC16A7 mRNA CTD PMID:34492290 Slc16a7 Rat thiram decreases expression ISO SLC16A7 (Homo sapiens) 6480464 Thiram results in decreased expression of SLC16A7 mRNA CTD PMID:38568856 Slc16a7 Rat titanium dioxide decreases expression ISO Slc16a7 (Mus musculus) 6480464 titanium dioxide results in decreased expression of SLC16A7 mRNA CTD PMID:23557971 Slc16a7 Rat titanium dioxide increases expression ISO Slc16a7 (Mus musculus) 6480464 titanium dioxide results in increased expression of SLC16A7 mRNA CTD PMID:31298478 Slc16a7 Rat titanium dioxide multiple interactions ISO Slc16a7 (Mus musculus) 6480464 Resveratrol inhibits the reaction [titanium dioxide results in increased expression of SLC16A7 mRNA] CTD PMID:31298478 Slc16a7 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of SLC16A7 mRNA CTD PMID:19448997 and PMID:33387578 Slc16a7 Rat trichostatin A increases expression ISO SLC16A7 (Homo sapiens) 6480464 trichostatin A results in increased expression of SLC16A7 mRNA CTD PMID:24935251 more ... Slc16a7 Rat trichostatin A multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC16A7 mRNA CTD PMID:27188386 Slc16a7 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of SLC16A7 mRNA CTD PMID:30589522 Slc16a7 Rat triphenyl phosphate affects expression ISO SLC16A7 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SLC16A7 mRNA CTD PMID:37042841 Slc16a7 Rat Triptolide decreases expression ISO Slc16a7 (Mus musculus) 6480464 triptolide results in decreased expression of SLC16A7 mRNA CTD PMID:32835833 Slc16a7 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of SLC16A7 mRNA CTD PMID:24136188 Slc16a7 Rat valproic acid increases expression ISO Slc16a7 (Mus musculus) 6480464 Valproic Acid results in increased expression of SLC16A7 mRNA CTD PMID:24535564 Slc16a7 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of SLC16A7 mRNA CTD PMID:29427782 Slc16a7 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of SLC16A7 mRNA CTD PMID:29427782 Slc16a7 Rat valproic acid multiple interactions ISO SLC16A7 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC16A7 mRNA CTD PMID:27188386 Slc16a7 Rat valproic acid increases expression ISO SLC16A7 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SLC16A7 mRNA CTD PMID:23179753 more ... Slc16a7 Rat valproic acid decreases methylation ISO SLC16A7 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of SLC16A7 gene CTD PMID:29154799 Slc16a7 Rat valproic acid affects expression ISO SLC16A7 (Homo sapiens) 6480464 Valproic Acid affects the expression of SLC16A7 mRNA CTD PMID:25979313 Slc16a7 Rat vancomycin increases expression ISO Slc16a7 (Mus musculus) 6480464 Vancomycin results in increased expression of SLC16A7 mRNA CTD PMID:18930951 Slc16a7 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of SLC16A7 mRNA CTD PMID:23034163
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 3-chloropropane-1,2-diol (EXP) 3-iodothyronamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acrolein (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amiodarone (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-chloroethyl) sulfide (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) chlordecone (ISO) chlorpyrifos (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) copper(II) sulfate (ISO) coumarin (ISO) crocidolite asbestos (ISO) dibenz[a,h]anthracene (ISO) dieldrin (EXP) dorsomorphin (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethanol (ISO) finasteride (EXP) flavonoids (EXP) flutamide (EXP) formaldehyde (ISO) geldanamycin (ISO) glafenine (EXP) heptachlor (EXP) hydrogen peroxide (ISO) inulin (ISO) isotretinoin (ISO) lanthanum trichloride (EXP) leflunomide (EXP) Licochalcone B (ISO) methapyrilene (EXP) methidathion (ISO) methylseleninic acid (ISO) mirex (EXP) nefazodone (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (EXP,ISO) PCB138 (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylephrine (EXP) phenylmercury acetate (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) tamibarotene (ISO) testosterone enanthate (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP,ISO) tetracycline (ISO) thallium (EXP) thallium sulfate (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (EXP,ISO) Triptolide (ISO) valdecoxib (EXP) valproic acid (EXP,ISO) vancomycin (ISO) vinclozolin (EXP)
Molecular Function
identical protein binding (IEA,ISO,ISS) lactate transmembrane transporter activity (IBA,IEA,ISO,ISS) monocarboxylic acid transmembrane transporter activity (IEA,TAS) protein binding (IPI,ISO) pyruvate transmembrane transporter activity (IEA,ISO,ISS) symporter activity (IDA,IEA,ISO) transmembrane transporter activity (IEA)
1.
Selective postsynaptic co-localization of MCT2 with AMPA receptor GluR2/3 subunits at excitatory synapses exhibiting AMPA receptor trafficking.
Bergersen LH, etal., Cereb Cortex. 2005 Apr;15(4):361-70. doi: 10.1093/cercor/bhh138.
2.
Characterization of the high-affinity monocarboxylate transporter MCT2 in Xenopus laevis oocytes.
Bröer S, etal., Biochem J. 1999 Aug 1;341 ( Pt 3):529-35. doi: 10.1042/0264-6021:3410529.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Cloning of the monocarboxylate transporter isoform MCT2 from rat testis provides evidence that expression in tissues is species-specific and may involve post-transcriptional regulation.
Jackson VN, etal., Biochem J 1997 Jun 1;324 ( Pt 2):447-53.
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
AR-C155858 is a potent inhibitor of monocarboxylate transporters MCT1 and MCT2 that binds to an intracellular site involving transmembrane helices 7-10.
Ovens MJ, etal., Biochem J. 2010 Jan 15;425(3):523-30. doi: 10.1042/BJ20091515.
8.
The inhibition of monocarboxylate transporter 2 (MCT2) by AR-C155858 is modulated by the associated ancillary protein.
Ovens MJ, etal., Biochem J. 2010 Oct 15;431(2):217-25. doi: 10.1042/BJ20100890.
9.
Highly differential expression of the monocarboxylate transporters MCT2 and MCT4 in the developing rat brain.
Rafiki A, etal., Neuroscience 2003;122(3):677-88.
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
14.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
15.
Basigin (CD147) is the target for organomercurial inhibition of monocarboxylate transporter isoforms 1 and 4: the ancillary protein for the insensitive MCT2 is EMBIGIN (gp70).
Wilson MC, etal., J Biol Chem. 2005 Jul 22;280(29):27213-21. Epub 2005 May 24.
Slc16a7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 62,929,067 - 63,096,995 (-) NCBI GRCr8 mRatBN7.2 7 61,043,667 - 61,211,547 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 61,051,167 - 61,154,994 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 62,936,997 - 63,040,542 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 65,139,665 - 65,243,207 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 64,915,969 - 65,019,570 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 68,438,341 - 68,606,312 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 68,446,193 - 68,549,763 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 68,633,417 - 68,801,189 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 65,210,148 - 65,313,572 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 65,230,721 - 65,390,741 (-) NCBI Celera 7 58,206,868 - 58,309,915 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
SLC16A7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 59,596,029 - 59,789,841 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 59,596,029 - 59,789,855 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 59,989,810 - 60,183,622 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 58,369,393 - 58,461,675 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 58,369,392 - 58,461,674 NCBI Celera 12 59,745,720 - 59,838,012 (+) NCBI Celera Cytogenetic Map 12 q14.1 NCBI HuRef 12 57,038,268 - 57,232,240 (+) NCBI HuRef CHM1_1 12 59,958,039 - 60,151,803 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 59,572,554 - 59,766,418 (+) NCBI T2T-CHM13v2.0
Slc16a7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 125,055,139 - 125,225,455 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 125,055,139 - 125,225,334 (-) Ensembl GRCm39 Ensembl GRCm38 10 125,219,270 - 125,389,586 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 125,219,270 - 125,389,465 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 124,664,541 - 124,765,591 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 124,630,545 - 124,731,595 (-) NCBI MGSCv36 mm8 Celera 10 127,630,780 - 127,731,940 (-) NCBI Celera Cytogenetic Map 10 D3 NCBI cM Map 10 72.31 NCBI
Slc16a7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 7,232,886 - 7,352,782 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 7,232,886 - 7,352,782 (+) NCBI ChiLan1.0 ChiLan1.0
SLC16A7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 34,537,931 - 34,726,021 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 34,529,686 - 34,722,531 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 29,128,600 - 29,317,797 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 29,390,576 - 29,587,897 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 29,390,576 - 29,528,851 (-) Ensembl panpan1.1 panPan2
SLC16A7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 3,333,000 - 3,500,684 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 3,334,126 - 3,496,150 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 3,398,668 - 3,564,721 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 3,356,472 - 3,522,599 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 3,357,277 - 3,519,865 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 3,323,639 - 3,489,625 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 3,565,685 - 3,731,591 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 3,691,746 - 3,857,780 (+) NCBI UU_Cfam_GSD_1.0
Slc16a7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 55,219,046 - 55,388,105 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936646 3,533,590 - 3,642,526 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936646 3,482,148 - 3,647,466 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC16A7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 24,713,267 - 24,875,003 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 24,713,009 - 24,871,891 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 26,710,139 - 26,864,757 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC16A7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 55,541,313 - 55,709,102 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 55,645,129 - 55,708,356 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 190,169,996 - 190,345,973 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc16a7
.
Predicted Target Of
Count of predictions: 133 Count of miRNA genes: 95 Interacting mature miRNAs: 119 Transcripts: ENSRNOT00000058036 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 2317035 Aia16 Adjuvant induced arthritis QTL 16 2.71 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 59238038 104238038 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 10059605 Kidm47 Kidney mass QTL 47 2.91 0.05 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 47251783 65728867 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 1298528 Bp169 Blood pressure QTL 169 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 61074194 106074194 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 61435 Cia4 Collagen induced arthritis QTL 4 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 7 58113224 62004598 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000058036 ⟹ ENSRNOP00000054845
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 61,051,167 - 61,154,994 (-) Ensembl Rnor_6.0 Ensembl 7 68,446,193 - 68,512,397 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000077670 ⟹ ENSRNOP00000075465
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 7 68,446,768 - 68,523,364 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000078014 ⟹ ENSRNOP00000073329
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 7 68,446,353 - 68,549,763 (-) Ensembl
RefSeq Acc Id:
NM_017302 ⟹ NP_058998
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,937,088 - 63,040,398 (-) NCBI mRatBN7.2 7 61,051,688 - 61,155,006 (-) NCBI Rnor_6.0 7 68,446,349 - 68,549,763 (-) NCBI Rnor_5.0 7 68,633,417 - 68,801,189 (-) NCBI RGSC_v3.4 7 65,210,148 - 65,313,572 (-) RGD Celera 7 58,206,868 - 58,309,915 (-) RGD
Sequence:
CAACAAGTGGCTAATGCGGCTTTTCTCTCGCTCTCCAGGTTGTTTTCGTCTCCAGTAGAAGCTCAGAAATGCCATCAGAGTCTTCAGTAAAGGCAACGGCGGCGCCGCCTCCATTCCCACTTCCTCCG
hide sequence
RefSeq Acc Id:
XM_006241432 ⟹ XP_006241494
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,020,967 (-) NCBI mRatBN7.2 7 61,043,667 - 61,135,526 (-) NCBI Rnor_6.0 7 68,438,341 - 68,530,585 (-) NCBI Rnor_5.0 7 68,633,417 - 68,801,189 (-) NCBI
Sequence:
ATATTTCTTTGAACACAGATTTATATCTTGCTTTTCACTAAACATTTTATAAGCACCATGTTAC
hide sequence
RefSeq Acc Id:
XM_006241433 ⟹ XP_006241495
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,040,695 (-) NCBI mRatBN7.2 7 61,043,667 - 61,156,096 (-) NCBI Rnor_6.0 7 68,444,488 - 68,550,023 (-) NCBI Rnor_5.0 7 68,633,417 - 68,801,189 (-) NCBI
Sequence:
GTAGCAATTCTGAGTGCCAGACACGTCACCTTTTTGACCCTGGCTATAATTTAAGCCCAGTTTA
hide sequence
RefSeq Acc Id:
XM_006241434 ⟹ XP_006241496
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,096,995 (-) NCBI mRatBN7.2 7 61,043,667 - 61,211,545 (-) NCBI Rnor_6.0 7 68,438,341 - 68,606,311 (-) NCBI Rnor_5.0 7 68,633,417 - 68,801,189 (-) NCBI
Sequence:
CCCGCGCCCCCAGCCCGCGCCCCGCTCTCGCGTTCACCCCCCCGCACCGCACCCAGGCGCGCTC
hide sequence
RefSeq Acc Id:
XM_006241435 ⟹ XP_006241497
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,040,695 (-) NCBI mRatBN7.2 7 61,043,667 - 61,156,096 (-) NCBI Rnor_6.0 7 68,444,488 - 68,550,023 (-) NCBI Rnor_5.0 7 68,633,417 - 68,801,189 (-) NCBI
Sequence:
GTAGCAATTCTGAGTGCCAGACACGTCACCTTTTTGACCCTGGCTATAATTTAAGCCCAGTTTA
hide sequence
RefSeq Acc Id:
XM_006241436 ⟹ XP_006241498
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,096,983 (-) NCBI mRatBN7.2 7 61,043,667 - 61,211,547 (-) NCBI Rnor_6.0 7 68,438,341 - 68,606,312 (-) NCBI Rnor_5.0 7 68,633,417 - 68,801,189 (-) NCBI
Sequence:
CCCCGCGCCCCCAGCCCGCGCCCCGCTCTCGCGTTCACCCCCCCGCACCGCACCCAGGCGCGCTCCCGGGCACCCCAGCCCGTCTTTGCTTCCGCACCCCTCCCCCGGGCCTCGGCTGGCGAGGACAC
hide sequence
RefSeq Acc Id:
XM_039078611 ⟹ XP_038934539
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,096,982 (-) NCBI mRatBN7.2 7 61,043,667 - 61,211,545 (-) NCBI
RefSeq Acc Id:
XM_039078612 ⟹ XP_038934540
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,096,982 (-) NCBI mRatBN7.2 7 61,043,667 - 61,211,545 (-) NCBI
RefSeq Acc Id:
XM_039078613 ⟹ XP_038934541
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,096,983 (-) NCBI mRatBN7.2 7 61,043,667 - 61,211,547 (-) NCBI
RefSeq Acc Id:
XM_039078614 ⟹ XP_038934542
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,096,983 (-) NCBI mRatBN7.2 7 61,043,667 - 61,211,547 (-) NCBI
RefSeq Acc Id:
XM_039078615 ⟹ XP_038934543
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,096,983 (-) NCBI mRatBN7.2 7 61,043,667 - 61,211,547 (-) NCBI
RefSeq Acc Id:
XM_039078616 ⟹ XP_038934544
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,020,967 (-) NCBI mRatBN7.2 7 61,043,667 - 61,135,533 (-) NCBI
RefSeq Acc Id:
XM_039078617 ⟹ XP_038934545
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,020,967 (-) NCBI mRatBN7.2 7 61,052,466 - 61,135,520 (-) NCBI
RefSeq Acc Id:
XM_063263138 ⟹ XP_063119208
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,096,982 (-) NCBI
RefSeq Acc Id:
XM_063263139 ⟹ XP_063119209
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,040,699 (-) NCBI
RefSeq Acc Id:
XM_063263140 ⟹ XP_063119210
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,002,987 (-) NCBI
RefSeq Acc Id:
XM_063263141 ⟹ XP_063119211
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 62,929,067 - 63,096,982 (-) NCBI
RefSeq Acc Id:
NP_058998 ⟸ NM_017302
- UniProtKB:
Q63649 (UniProtKB/Swiss-Prot), Q63344 (UniProtKB/Swiss-Prot), Q66HS9 (UniProtKB/TrEMBL)
- Sequence:
MPSESSVKATAAPPPFPLPPDGGWGWVVVCASFISIGFSYAFPKAVTVFFNDIKDIFKTTSSQIAWISSIMLAVMYAGGPISSVLVNNYGSRPVVIVGGLLCCTGMILASFSSSVIELYLTVGFIGGL
hide sequence
RefSeq Acc Id:
XP_006241498 ⟸ XM_006241436
- Peptide Label:
isoform X1
- UniProtKB:
Q63649 (UniProtKB/Swiss-Prot), Q63344 (UniProtKB/Swiss-Prot), Q66HS9 (UniProtKB/TrEMBL)
- Sequence:
MPSESSVKATAAPPPFPLPPDGGWGWVVVCASFISIGFSYAFPKAVTVFFNDIKDIFKTTSSQIAWISSIMLAVMYAGGPISSVLVNNYGSRPVVIVGGLLCCTGMILASFSSSVIELYLTVGFIGGL
hide sequence
RefSeq Acc Id:
XP_006241496 ⟸ XM_006241434
- Peptide Label:
isoform X1
- UniProtKB:
Q63649 (UniProtKB/Swiss-Prot), Q63344 (UniProtKB/Swiss-Prot), Q66HS9 (UniProtKB/TrEMBL)
- Sequence:
MPSESSVKATAAPPPFPLPPDGGWGWVVVCASFISIGFSYAFPKAVTVFFNDIKDIFKTTSSQIAWISSIMLAVMYAGGPISSVLVNNYGSRPVVIVGGLLCCTGMILASFSSSVIELYLTVGFIGGL
hide sequence
RefSeq Acc Id:
XP_006241497 ⟸ XM_006241435
- Peptide Label:
isoform X1
- UniProtKB:
Q63649 (UniProtKB/Swiss-Prot), Q63344 (UniProtKB/Swiss-Prot), Q66HS9 (UniProtKB/TrEMBL)
- Sequence:
MPSESSVKATAAPPPFPLPPDGGWGWVVVCASFISIGFSYAFPKAVTVFFNDIKDIFKTTSSQIAWISSIMLAVMYAGGPISSVLVNNYGSRPVVIVGGLLCCTGMILASFSSSVIELYLTVGFIGGL
hide sequence
RefSeq Acc Id:
XP_006241495 ⟸ XM_006241433
- Peptide Label:
isoform X1
- UniProtKB:
Q63649 (UniProtKB/Swiss-Prot), Q63344 (UniProtKB/Swiss-Prot), Q66HS9 (UniProtKB/TrEMBL)
- Sequence:
MPSESSVKATAAPPPFPLPPDGGWGWVVVCASFISIGFSYAFPKAVTVFFNDIKDIFKTTSSQIAWISSIMLAVMYAGGPISSVLVNNYGSRPVVIVGGLLCCTGMILASFSSSVIELYLTVGFIGGL
hide sequence
RefSeq Acc Id:
XP_006241494 ⟸ XM_006241432
- Peptide Label:
isoform X1
- UniProtKB:
Q63649 (UniProtKB/Swiss-Prot), Q63344 (UniProtKB/Swiss-Prot), Q66HS9 (UniProtKB/TrEMBL)
- Sequence:
MPSESSVKATAAPPPFPLPPDGGWGWVVVCASFISIGFSYAFPKAVTVFFNDIKDIFKTTSSQIAWISSIMLAVMYAGGPISSVLVNNYGSRPVVIVGGLLCCTGMILASFSSSVIELYLTVGFIGGL
hide sequence
Ensembl Acc Id:
ENSRNOP00000054845 ⟸ ENSRNOT00000058036
Ensembl Acc Id:
ENSRNOP00000075465 ⟸ ENSRNOT00000077670
Ensembl Acc Id:
ENSRNOP00000073329 ⟸ ENSRNOT00000078014
RefSeq Acc Id:
XP_038934543 ⟸ XM_039078615
- Peptide Label:
isoform X1
- UniProtKB:
Q63649 (UniProtKB/Swiss-Prot), Q63344 (UniProtKB/Swiss-Prot), Q66HS9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934542 ⟸ XM_039078614
- Peptide Label:
isoform X1
- UniProtKB:
Q63649 (UniProtKB/Swiss-Prot), Q63344 (UniProtKB/Swiss-Prot), Q66HS9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934541 ⟸ XM_039078613
- Peptide Label:
isoform X1
- UniProtKB:
Q63649 (UniProtKB/Swiss-Prot), Q63344 (UniProtKB/Swiss-Prot), Q66HS9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934540 ⟸ XM_039078612
- Peptide Label:
isoform X1
- UniProtKB:
Q63649 (UniProtKB/Swiss-Prot), Q63344 (UniProtKB/Swiss-Prot), Q66HS9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934539 ⟸ XM_039078611
- Peptide Label:
isoform X1
- UniProtKB:
Q63649 (UniProtKB/Swiss-Prot), Q63344 (UniProtKB/Swiss-Prot), Q66HS9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934544 ⟸ XM_039078616
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038934545 ⟸ XM_039078617
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063119208 ⟸ XM_063263138
- Peptide Label:
isoform X1
- UniProtKB:
Q66HS9 (UniProtKB/Swiss-Prot), Q63649 (UniProtKB/Swiss-Prot), Q63344 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063119211 ⟸ XM_063263141
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063119209 ⟸ XM_063263139
- Peptide Label:
isoform X1
- UniProtKB:
Q66HS9 (UniProtKB/Swiss-Prot), Q63649 (UniProtKB/Swiss-Prot), Q63344 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063119210 ⟸ XM_063263140
- Peptide Label:
isoform X1
- UniProtKB:
Q66HS9 (UniProtKB/Swiss-Prot), Q63649 (UniProtKB/Swiss-Prot), Q63344 (UniProtKB/Swiss-Prot)
RGD ID: 13695239 Promoter ID: EPDNEW_R5764 Type: multiple initiation site Name: Slc16a7_1 Description: solute carrier family 16 member 7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 68,549,776 - 68,549,836 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-09
Slc16a7
solute carrier family 16 member 7
Slc16a7
solute carrier family 16 (monocarboxylate transporter), member 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-08-02
Slc16a7
solute carrier family 16 (monocarboxylate transporter), member 7
Slc16a7
solute carrier family 16, member 7 (monocarboxylic acid transporter 2)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-19
Slc16a7
solute carrier family 16, member 7 (monocarboxylic acid transporter 2)
Slc16a7
solute carrier family 16 (monocarboxylic acid transporters), member 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Slc16a7
solute carrier family 16 (monocarboxylic acid transporters), member 7
solute carrier family 16, member 7
Name updated
1299863 APPROVED
2002-06-10
Slc16a7
solute carrier family 16, member 7
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_expression
expressed in neurons and some astrocyte populations
734496
