Symbol:
Slc1a6
Name:
solute carrier family 1 member 6
RGD ID:
620340
Description:
Enables high-affinity L-glutamate transmembrane transporter activity and monoatomic anion transmembrane transporter activity. Involved in L-glutamate import across plasma membrane. Located in plasma membrane. Part of membrane protein complex. Is active in parallel fiber to Purkinje cell synapse and postsynaptic membrane. Orthologous to human SLC1A6 (solute carrier family 1 member 6); PARTICIPATES IN glutamate signaling pathway; INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
EAAT4; excitatory amino acid transporter 4; high affinity aspartate/glutamate transporter; high-affinity neuronal glutamate transporter; MGC114297; sodium-dependent glutamate/aspartate transporter; solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLC1A6 (solute carrier family 1 member 6) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Slc1a6 (solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slc1a6 (solute carrier family 1 member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SLC1A6 (solute carrier family 1 member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLC1A6 (solute carrier family 1 member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc1a6 (solute carrier family 1 member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLC1A6 (solute carrier family 1 member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SLC1A6 (solute carrier family 1 member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slc1a6 (solute carrier family 1 member 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
DMAC2 (distal membrane arm assembly component 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
SLC1A6 (solute carrier family 1 member 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Slc1a6 (solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc1a6 (solute carrier family 1 member 6)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
glt-4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Eaat1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
slc1a6
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 11,492,422 - 11,521,007 (-) NCBI GRCr8 mRatBN7.2 7 10,841,836 - 10,870,424 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 10,841,837 - 10,870,449 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 13,661,837 - 13,690,559 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 15,539,283 - 15,568,001 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 13,417,320 - 13,445,815 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 13,730,101 - 13,758,170 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 13,730,253 - 13,751,271 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 13,893,841 - 13,921,839 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 12,393,284 - 12,419,893 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 12,393,284 - 12,419,880 (-) NCBI Celera 7 8,958,917 - 8,988,056 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc1a6 Rat 17alpha-ethynylestradiol multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SLC1A6 mRNA CTD PMID:17942748 Slc1a6 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Slc1a6 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Slc1a6 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SLC1A6 mRNA CTD PMID:17942748 Slc1a6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Slc1a6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SLC1A6 mRNA CTD PMID:21570461 Slc1a6 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Slc1a6 Rat 2-hydroxypropanoic acid increases expression ISO SLC1A6 (Homo sapiens) 6480464 Lactic Acid results in increased expression of SLC1A6 mRNA CTD PMID:30851411 Slc1a6 Rat 3,4-dichloroaniline decreases expression ISO SLC1A6 (Homo sapiens) 6480464 3 and 4-dichloroaniline results in decreased expression of SLC1A6 mRNA CTD PMID:24172598 Slc1a6 Rat 4,4'-sulfonyldiphenol decreases expression ISO Slc1a6 (Mus musculus) 6480464 bisphenol S results in decreased expression of SLC1A6 mRNA CTD PMID:30951980 Slc1a6 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLC1A6 mRNA CTD PMID:36041667 Slc1a6 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SLC1A6 mRNA CTD PMID:24780913 Slc1a6 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of SLC1A6 mRNA CTD PMID:31881176 Slc1a6 Rat acrylamide decreases expression ISO SLC1A6 (Homo sapiens) 6480464 Acrylamide results in decreased expression of SLC1A6 mRNA CTD PMID:32763439 Slc1a6 Rat all-trans-retinoic acid decreases expression ISO SLC1A6 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SLC1A6 mRNA CTD PMID:21934132 Slc1a6 Rat all-trans-retinoic acid affects expression ISO SLC1A6 (Homo sapiens) 6480464 Tretinoin affects the expression of SLC1A6 mRNA CTD PMID:15498508 Slc1a6 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SLC1A6 mRNA CTD PMID:16483693 Slc1a6 Rat Ampullosporin multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in increased expression of SLC1A6 mRNA CTD PMID:16635253 Slc1a6 Rat androgen antagonist multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in increased expression of SLC1A6 mRNA CTD PMID:25607892 Slc1a6 Rat arsenite(3-) decreases expression ISO Slc1a6 (Mus musculus) 6480464 arsenite results in decreased expression of SLC1A6 mRNA CTD PMID:33053406 Slc1a6 Rat Azoxymethane multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLC1A6 mRNA CTD PMID:29950665 Slc1a6 Rat benzo[a]pyrene increases methylation ISO SLC1A6 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SLC1A6 exon CTD PMID:27901495 Slc1a6 Rat benzo[a]pyrene affects methylation ISO SLC1A6 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SLC1A6 promoter CTD PMID:27901495 Slc1a6 Rat bis(2-chloroethyl) sulfide increases expression ISO Slc1a6 (Mus musculus) 6480464 Mustard Gas results in increased expression of SLC1A6 mRNA CTD PMID:15674843 Slc1a6 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of SLC1A6 mRNA CTD PMID:25607892 Slc1a6 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC1A6 mRNA CTD PMID:39150890 Slc1a6 Rat bis(2-ethylhexyl) phthalate increases expression ISO SLC1A6 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of SLC1A6 mRNA CTD PMID:31163220 Slc1a6 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLC1A6 mRNA more ... CTD PMID:25607892 more ... Slc1a6 Rat bisphenol A decreases expression ISO Slc1a6 (Mus musculus) 6480464 bisphenol A results in decreased expression of SLC1A6 mRNA CTD PMID:30951980 Slc1a6 Rat bisphenol F decreases expression ISO Slc1a6 (Mus musculus) 6480464 bisphenol F results in decreased expression of SLC1A6 mRNA CTD PMID:30951980 Slc1a6 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SLC1A6 mRNA CTD PMID:36041667 Slc1a6 Rat Butylbenzyl phthalate multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC1A6 mRNA CTD PMID:39150890 Slc1a6 Rat Butylparaben multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in increased expression of SLC1A6 mRNA CTD PMID:25607892 Slc1a6 Rat calcitriol increases expression ISO SLC1A6 (Homo sapiens) 6480464 Calcitriol results in increased expression of SLC1A6 mRNA CTD PMID:16002434 Slc1a6 Rat CGP 52608 multiple interactions ISO SLC1A6 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SLC1A6 gene] CTD PMID:28238834 Slc1a6 Rat chlorpyrifos multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [Chlorpyrifos co-treated with NGF protein] results in increased expression of SLC1A6 mRNA CTD PMID:20600679 Slc1a6 Rat DDE multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of SLC1A6 mRNA CTD PMID:25607892 Slc1a6 Rat dextran sulfate multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLC1A6 mRNA CTD PMID:29950665 Slc1a6 Rat dibutyl phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of SLC1A6 mRNA CTD PMID:25607892 Slc1a6 Rat dibutyl phthalate multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC1A6 mRNA CTD PMID:39150890 Slc1a6 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of SLC1A6 mRNA CTD PMID:18636392 Slc1a6 Rat diethyl phthalate multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC1A6 mRNA CTD PMID:39150890 Slc1a6 Rat diisobutyl phthalate multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC1A6 mRNA CTD PMID:39150890 Slc1a6 Rat diisononyl phthalate multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC1A6 mRNA CTD PMID:39150890 Slc1a6 Rat diuron increases expression ISO SLC1A6 (Homo sapiens) 6480464 Diuron metabolite results in increased expression of SLC1A6 mRNA CTD PMID:24172598 Slc1a6 Rat dorsomorphin multiple interactions ISO SLC1A6 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Slc1a6 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of SLC1A6 mRNA CTD PMID:29391264 Slc1a6 Rat enzacamene multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in increased expression of SLC1A6 mRNA CTD PMID:25607892 Slc1a6 Rat epoxiconazole multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of SLC1A6 mRNA CTD PMID:25607892 Slc1a6 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of SLC1A6 mRNA CTD PMID:20655511 Slc1a6 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of SLC1A6 mRNA CTD PMID:30307764 Slc1a6 Rat folic acid increases expression ISO Slc1a6 (Mus musculus) 6480464 Folic Acid results in increased expression of SLC1A6 mRNA CTD PMID:25629700 Slc1a6 Rat furan increases expression EXP 6480464 furan results in increased expression of SLC1A6 mRNA CTD PMID:25539665 Slc1a6 Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of SLC1A6 mRNA CTD PMID:24395379 Slc1a6 Rat indometacin increases expression ISO SLC1A6 (Homo sapiens) 6480464 Indomethacin results in increased expression of SLC1A6 mRNA CTD PMID:24737281 Slc1a6 Rat ketamine multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in increased expression of SLC1A6 mRNA CTD PMID:16635253 Slc1a6 Rat lead(0) affects expression ISO SLC1A6 (Homo sapiens) 6480464 Lead affects the expression of SLC1A6 mRNA CTD PMID:28903495 Slc1a6 Rat linuron multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of SLC1A6 mRNA CTD PMID:25607892 Slc1a6 Rat lipopolysaccharide increases expression ISO Slc1a6 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of SLC1A6 mRNA CTD PMID:12057914 Slc1a6 Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of SLC1A6 gene CTD PMID:23303685 Slc1a6 Rat omega-6 fatty acid decreases expression ISO SLC1A6 (Homo sapiens) 6480464 Fatty Acids and Omega-6 results in decreased expression of SLC1A6 mRNA CTD PMID:16823509 Slc1a6 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of SLC1A6 mRNA CTD PMID:18636392 Slc1a6 Rat paracetamol multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in increased expression of SLC1A6 mRNA CTD PMID:25607892 Slc1a6 Rat PCB138 multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Slc1a6 Rat phenylmercury acetate decreases expression ISO SLC1A6 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of SLC1A6 mRNA CTD PMID:26272509 Slc1a6 Rat phenylmercury acetate multiple interactions ISO SLC1A6 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SLC1A6 mRNA CTD PMID:27188386 Slc1a6 Rat potassium dichromate increases expression ISO SLC1A6 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of SLC1A6 mRNA CTD PMID:11678601 Slc1a6 Rat prochloraz multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of SLC1A6 mRNA CTD PMID:25607892 Slc1a6 Rat procymidone multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of SLC1A6 mRNA CTD PMID:25607892 Slc1a6 Rat rac-lactic acid increases expression ISO SLC1A6 (Homo sapiens) 6480464 Lactic Acid results in increased expression of SLC1A6 mRNA CTD PMID:30851411 Slc1a6 Rat SB 431542 multiple interactions ISO SLC1A6 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Slc1a6 Rat sodium arsenite increases expression ISO SLC1A6 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SLC1A6 mRNA CTD PMID:34032870 Slc1a6 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of SLC1A6 mRNA CTD PMID:19281266 Slc1a6 Rat tamibarotene decreases expression ISO SLC1A6 (Homo sapiens) 6480464 tamibarotene results in decreased expression of SLC1A6 mRNA CTD PMID:15498508 Slc1a6 Rat tetrachloromethane affects expression ISO Slc1a6 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of SLC1A6 mRNA CTD PMID:17484886 Slc1a6 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SLC1A6 mRNA CTD PMID:30723492 Slc1a6 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of SLC1A6 mRNA CTD PMID:12734012 Slc1a6 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SLC1A6 mRNA CTD PMID:23411599 Slc1a6 Rat titanium dioxide multiple interactions ISO Slc1a6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of SLC1A6 mRNA CTD PMID:29950665 Slc1a6 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in decreased expression of SLC1A6 mRNA CTD PMID:31129395 Slc1a6 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of SLC1A6 gene CTD PMID:27618143 Slc1a6 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of SLC1A6 mRNA CTD PMID:33387578 Slc1a6 Rat trichostatin A decreases expression ISO SLC1A6 (Homo sapiens) 6480464 trichostatin A results in decreased expression of SLC1A6 mRNA CTD PMID:24935251 and PMID:26272509 Slc1a6 Rat trichostatin A multiple interactions ISO SLC1A6 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SLC1A6 mRNA CTD PMID:27188386 Slc1a6 Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of SLC1A6 mRNA CTD PMID:30589522 Slc1a6 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of SLC1A6 mRNA CTD PMID:32428529 Slc1a6 Rat valproic acid multiple interactions ISO SLC1A6 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SLC1A6 mRNA CTD PMID:27188386 Slc1a6 Rat valproic acid decreases expression ISO SLC1A6 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SLC1A6 mRNA CTD PMID:23179753 more ... Slc1a6 Rat valproic acid increases expression ISO SLC1A6 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SLC1A6 mRNA CTD PMID:24935251 Slc1a6 Rat vinclozolin multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of SLC1A6 mRNA CTD PMID:25607892
Imported Annotations - KEGG (archival)
17alpha-ethynylestradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-hydroxypropanoic acid (ISO) 3,4-dichloroaniline (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) Ampullosporin (EXP) androgen antagonist (EXP) arsenite(3-) (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) Butylbenzyl phthalate (ISO) Butylparaben (EXP) calcitriol (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) DDE (EXP) dextran sulfate (ISO) dibutyl phthalate (EXP,ISO) dichlorine (EXP) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) diuron (ISO) dorsomorphin (ISO) endosulfan (EXP) enzacamene (EXP) epoxiconazole (EXP) ethanol (EXP) fenvalerate (EXP) folic acid (ISO) furan (EXP) glycidol (EXP) indometacin (ISO) ketamine (EXP) lead(0) (ISO) linuron (EXP) lipopolysaccharide (ISO) methoxychlor (EXP) omega-6 fatty acid (ISO) ozone (EXP) paracetamol (EXP) PCB138 (ISO) phenylmercury acetate (ISO) potassium dichromate (ISO) prochloraz (EXP) procymidone (EXP) rac-lactic acid (ISO) SB 431542 (ISO) sodium arsenite (ISO) Soman (EXP) tamibarotene (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) tributylstannane (EXP) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (EXP) valproic acid (EXP,ISO) vinclozolin (EXP)
1.
Caveolin-1 Sensitivity of Excitatory Amino Acid Transporters EAAT1, EAAT2, EAAT3, and EAAT4.
Abousaab A, etal., J Membr Biol. 2016 Jun;249(3):239-49. doi: 10.1007/s00232-015-9863-0. Epub 2015 Dec 21.
2.
Similar perisynaptic glial localization for the Na+,K+-ATPase alpha 2 subunit and the glutamate transporters GLAST and GLT-1 in the rat somatosensory cortex.
Cholet N, etal., Cereb Cortex 2002 May;12(5):515-25.
3.
The glutamate transporter EAAT4 in rat cerebellar Purkinje cells: a glutamate-gated chloride channel concentrated near the synapse in parts of the dendritic membrane facing astroglia.
Dehnes Y, etal., J Neurosci. 1998 May 15;18(10):3606-19.
4.
Glutamate transporter protein subtypes are expressed differentially during rat CNS development.
Furuta A, etal., J Neurosci. 1997 Nov 1;17(21):8363-75.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Slc1a6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 11,492,422 - 11,521,007 (-) NCBI GRCr8 mRatBN7.2 7 10,841,836 - 10,870,424 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 10,841,837 - 10,870,449 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 13,661,837 - 13,690,559 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 15,539,283 - 15,568,001 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 13,417,320 - 13,445,815 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 13,730,101 - 13,758,170 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 13,730,253 - 13,751,271 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 13,893,841 - 13,921,839 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 12,393,284 - 12,419,893 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 12,393,284 - 12,419,880 (-) NCBI Celera 7 8,958,917 - 8,988,056 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
SLC1A6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 14,950,033 - 15,010,643 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 14,950,033 - 15,022,990 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 15,060,845 - 15,121,455 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 14,921,991 - 14,944,730 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 14,921,990 - 14,944,730 NCBI Celera 19 14,956,703 - 14,979,425 (-) NCBI Celera Cytogenetic Map 19 p13.12 NCBI HuRef 19 14,628,668 - 14,688,622 (-) NCBI HuRef CHM1_1 19 15,060,322 - 15,120,899 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 15,074,841 - 15,135,544 (-) NCBI T2T-CHM13v2.0
Slc1a6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 78,615,923 - 78,650,659 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 78,616,330 - 78,650,599 (+) Ensembl GRCm39 Ensembl GRCm38 10 78,780,086 - 78,814,825 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 78,780,496 - 78,814,765 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 78,243,241 - 78,277,570 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 78,183,631 - 78,217,894 (+) NCBI MGSCv36 mm8 Celera 10 79,802,330 - 79,836,572 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Slc1a6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 8,289,734 - 8,314,874 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 8,270,601 - 8,314,874 (+) NCBI ChiLan1.0 ChiLan1.0
SLC1A6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 19,865,671 - 19,896,124 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 18,882,684 - 18,913,146 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 14,499,333 - 14,529,781 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 15,470,222 - 15,498,980 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 15,470,222 - 15,526,471 (-) Ensembl panpan1.1 panPan2
SLC1A6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 47,133,237 - 47,143,512 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 47,097,593 - 47,143,512 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 46,976,526 - 46,993,225 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 47,618,429 - 47,635,339 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 47,589,356 - 47,635,118 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 46,849,336 - 46,866,041 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 47,267,243 - 47,284,105 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 47,539,683 - 47,556,398 (+) NCBI UU_Cfam_GSD_1.0
Slc1a6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 205,914,191 - 205,929,855 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936596 5,464,862 - 5,478,641 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936596 5,464,850 - 5,478,763 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC1A6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 62,601,758 - 62,623,371 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 62,601,763 - 62,623,597 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 62,160,514 - 62,181,952 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC1A6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 13,537,902 - 13,567,333 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 13,538,064 - 13,558,959 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666074 6,023,993 - 6,056,899 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc1a6
.
Predicted Target Of
Count of predictions: 151 Count of miRNA genes: 120 Interacting mature miRNAs: 128 Transcripts: ENSRNOT00000009931 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
7
2
20
107
67
70
44
12
44
6
120
44
93
23
60
26
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009931 ⟹ ENSRNOP00000009931
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 10,841,837 - 10,870,449 (-) Ensembl Rnor_6.0 Ensembl 7 13,730,253 - 13,751,271 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000108905 ⟹ ENSRNOP00000096116
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 10,841,837 - 10,870,449 (-) Ensembl
RefSeq Acc Id:
NM_032065 ⟹ NP_114454
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 11,492,422 - 11,521,007 (-) NCBI mRatBN7.2 7 10,841,836 - 10,870,424 (-) NCBI Rnor_6.0 7 13,730,101 - 13,758,099 (-) NCBI Rnor_5.0 7 13,893,841 - 13,921,839 (-) NCBI RGSC_v3.4 7 12,393,284 - 12,419,893 (-) RGD Celera 7 8,958,917 - 8,988,056 (-) RGD
Sequence:
GAATTCGGCACGAGCGCAGACACAGAGCGGGTCCCTGGCGGGTCCCTGCGGACCCGGCCAGGCGCTTCCGCGGGTTCTGGCTTTTGCATCCCGGCGCAGCGCGCAGGCGGAGGCGCAGGCAAGGCGGC
hide sequence
RefSeq Acc Id:
NP_114454 ⟸ NM_032065
- UniProtKB:
P97683 (UniProtKB/Swiss-Prot), O35921 (UniProtKB/Swiss-Prot), Q7TSX6 (UniProtKB/TrEMBL)
- Sequence:
MSSHGNSLFLRESGAGGGCLQGLQDSLQQRALRTRLRLQTMTREHVRRFLRRNAFILLTVSAVIIGVSLAFALRPYQLTYRQIKYFSFPGELLMRMLQMLVLPLIVSSRVTGMASLDNKATGRMGMRA
hide sequence
Ensembl Acc Id:
ENSRNOP00000009931 ⟸ ENSRNOT00000009931
Ensembl Acc Id:
ENSRNOP00000096116 ⟸ ENSRNOT00000108905
BioCyc Gene G2FUF-34849 BioCyc
Ensembl Genes ENSRNOG00000007509 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000009931.6 UniProtKB/TrEMBL
ENSRNOT00000108905 ENTREZGENE
ENSRNOT00000108905.1 UniProtKB/TrEMBL
Gene3D-CATH 1.10.3860.10 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7315936 IMAGE-MGC_LOAD
InterPro DAACS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Na-dicarboxylate_symporter UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Na-dicarboxylate_symporter_CS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Na:dicarbo_symporter_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:84012 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE MGC:114297 IMAGE-MGC_LOAD
NCBI Gene 84012 ENTREZGENE
PANTHER EXCITATORY AMINO ACID TRANSPORTER 4 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SODIUM/DICARBOXYLATE SYMPORTER-RELATED UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam SDF UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Slc1a6 PhenoGen
PRINTS EDTRNSPORT UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE NA_DICARBOXYL_SYMP_1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NA_DICARBOXYL_SYMP_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000007509 RatGTEx
Superfamily-SCOP SSF118215 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A6K924_RAT UniProtKB/TrEMBL
EAA4_RAT UniProtKB/Swiss-Prot
F1LR26_RAT UniProtKB/TrEMBL
O35921 ENTREZGENE
P97683 ENTREZGENE
Q7TSX6 ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary P97683 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-25
Slc1a6
solute carrier family 1 member 6
Slc1a6
solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Slc1a6
solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Slc1a6
solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
Symbol and Name status set to provisional
70820 PROVISIONAL
