Advanced Search (OLGA)

Gene: Slc6a7 (solute carrier family 6 member 7) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Slc6a7

Name:

solute carrier family 6 member 7

RGD ID:

620928

Description:

Enables L-proline transmembrane transporter activity and proline:sodium symporter activity. Involved in proline transport and protein catabolic process. Is active in several cellular components, including Schaffer collateral - CA1 synapse; presynaptic membrane; and synaptic vesicle membrane. Orthologous to human SLC6A7 (solute carrier family 6 member 7); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

L-proline transporter; LOC103690061; proline transporter; Prot; sodium-dependent proline transporter; sodium-dependent proline transporter-like; solute carrier family 6 (neurotransmitter transporter L-proline) member 7; solute carrier family 6 (neurotransmitter transporter), member 7; solute carrier family 6 (neurotransmitter transporter, L-proline), member 7

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLC6A7 (solute carrier family 6 member 7)	HGNC	EggNOG, Ensembl, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Slc6a7 (solute carrier family 6 (neurotransmitter transporter, L-proline), member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Slc6a7 (solute carrier family 6 member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLC6A7 (solute carrier family 6 member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLC6A7 (solute carrier family 6 member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slc6a7 (solute carrier family 6 member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLC6A7 (solute carrier family 6 member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLC6A7 (solute carrier family 6 member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slc6a7 (solute carrier family 6 member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PSMB5 (proteasome 20S subunit beta 5)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SLC6A7 (solute carrier family 6 member 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Slc6a7 (solute carrier family 6 (neurotransmitter transporter, L-proline), member 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	snf-2	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	snf-5	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Drosophila melanogaster (fruit fly):	Ntl	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER)
Caenorhabditis elegans (roundworm):	snf-9	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	snf-7	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	snf-10	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	slc6a7	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	56,718,849 - 56,737,702 (-)	NCBI		GRCr8
mRatBN7.2	18	54,448,464 - 54,467,319 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	54,448,464 - 54,467,319 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	56,536,530 - 56,555,331 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	57,251,136 - 57,269,935 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	55,072,309 - 55,091,168 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	56,305,765 - 56,325,179 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	56,305,735 - 56,331,991 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	55,557,703 - 55,564,493 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	18	55,539,473 - 55,557,682 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	56,958,965 - 56,977,159 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	57,031,196 - 57,049,391 (-)	NCBI
Celera	18	52,602,558 - 52,620,980 (-)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slc6a7	Rat	familial adenomatous polyposis 1		ISO	SLC6A7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial adenomatous polyposis 1	ClinVar	PMID:17963004 more ...
Slc6a7	Rat	Hereditary Neoplastic Syndromes		ISO	SLC6A7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary cancer-predisposing syndrome	ClinVar	PMID:17963004 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slc6a7	Rat	(S)-nicotine	decreases expression	ISO	Slc6a7 (Mus musculus)	6480464	Nicotine results in decreased expression of SLC6A7 mRNA	CTD	PMID:21955143
Slc6a7	Rat	1,2-dimethylhydrazine	affects expression	ISO	Slc6a7 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine affects the expression of SLC6A7 mRNA	CTD	PMID:22206623
Slc6a7	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of SLC6A7 mRNA	CTD	PMID:32109520
Slc6a7	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Slc6a7	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	Slc6a7 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of SLC6A7 mRNA	CTD	PMID:20188158
Slc6a7	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of SLC6A7 mRNA	CTD	PMID:24780913
Slc6a7	Rat	aflatoxin B1	decreases methylation	ISO	SLC6A7 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of SLC6A7 intron	CTD	PMID:30157460
Slc6a7	Rat	aldehydo-D-glucose	multiple interactions	ISO	Slc6a7 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of SLC6A7 mRNA	CTD	PMID:37567420
Slc6a7	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of SLC6A7 mRNA	CTD	PMID:16483693
Slc6a7	Rat	benzo[a]pyrene	increases expression	ISO	Slc6a7 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of SLC6A7 mRNA	CTD	PMID:22228805
Slc6a7	Rat	benzo[a]pyrene	increases methylation	ISO	SLC6A7 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of SLC6A7 3' UTR and Benzo(a)pyrene results in increased methylation of SLC6A7 5' UTR	CTD	PMID:27901495
Slc6a7	Rat	benzo[a]pyrene	affects methylation	ISO	SLC6A7 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of SLC6A7 intron and Benzo(a)pyrene affects the methylation of SLC6A7 promoter	CTD	PMID:27901495 and PMID:30157460
Slc6a7	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	Slc6a7 (Mus musculus)	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC6A7 mRNA	CTD	PMID:39150890
Slc6a7	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SLC6A7 mRNA	CTD	PMID:25181051 more ...
Slc6a7	Rat	bisphenol A	decreases expression	ISO	Slc6a7 (Mus musculus)	6480464	bisphenol A results in decreased expression of SLC6A7 mRNA	CTD	PMID:32156529
Slc6a7	Rat	bisphenol A	increases expression	ISO	Slc6a7 (Mus musculus)	6480464	bisphenol A results in increased expression of SLC6A7 mRNA	CTD	PMID:30951980
Slc6a7	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Genistein] results in decreased methylation of SLC6A7 gene and [bisphenol A co-treated with Genistein] results in increased methylation of SLC6A7 gene	CTD	PMID:28505145
Slc6a7	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of SLC6A7 gene	CTD	PMID:28505145
Slc6a7	Rat	bisphenol F	decreases expression	ISO	Slc6a7 (Mus musculus)	6480464	bisphenol F results in decreased expression of SLC6A7 mRNA	CTD	PMID:38685157
Slc6a7	Rat	Butylbenzyl phthalate	multiple interactions	ISO	Slc6a7 (Mus musculus)	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC6A7 mRNA	CTD	PMID:39150890
Slc6a7	Rat	cadmium dichloride	increases expression	ISO	SLC6A7 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of SLC6A7 mRNA	CTD	PMID:21457566
Slc6a7	Rat	CGP 52608	multiple interactions	ISO	SLC6A7 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to SLC6A7 gene]	CTD	PMID:28238834
Slc6a7	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of SLC6A7 mRNA	CTD	PMID:26033743
Slc6a7	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of SLC6A7 mRNA	CTD	PMID:26033743
Slc6a7	Rat	D-glucose	multiple interactions	ISO	Slc6a7 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of SLC6A7 mRNA	CTD	PMID:37567420
Slc6a7	Rat	dibutyl phthalate	multiple interactions	ISO	Slc6a7 (Mus musculus)	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC6A7 mRNA	CTD	PMID:39150890
Slc6a7	Rat	dichloroacetic acid	decreases expression	ISO	Slc6a7 (Mus musculus)	6480464	Dichloroacetic Acid results in decreased expression of SLC6A7 mRNA	CTD	PMID:28962523
Slc6a7	Rat	diethyl phthalate	multiple interactions	ISO	Slc6a7 (Mus musculus)	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC6A7 mRNA	CTD	PMID:39150890
Slc6a7	Rat	diisobutyl phthalate	multiple interactions	ISO	Slc6a7 (Mus musculus)	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC6A7 mRNA	CTD	PMID:39150890
Slc6a7	Rat	diisononyl phthalate	multiple interactions	ISO	Slc6a7 (Mus musculus)	6480464	[diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SLC6A7 mRNA	CTD	PMID:39150890
Slc6a7	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of SLC6A7 mRNA	CTD	PMID:29391264
Slc6a7	Rat	ethanol	increases expression	ISO	Slc6a7 (Mus musculus)	6480464	Ethanol results in increased expression of SLC6A7 mRNA	CTD	PMID:21955143
Slc6a7	Rat	fructose	multiple interactions	ISO	Slc6a7 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of SLC6A7 mRNA	CTD	PMID:37567420
Slc6a7	Rat	genistein	multiple interactions	EXP		6480464	[bisphenol A co-treated with Genistein] results in decreased methylation of SLC6A7 gene and [bisphenol A co-treated with Genistein] results in increased methylation of SLC6A7 gene	CTD	PMID:28505145
Slc6a7	Rat	genistein	increases expression	ISO	Slc6a7 (Mus musculus)	6480464	Genistein results in increased expression of SLC6A7 mRNA	CTD	PMID:32186404
Slc6a7	Rat	glucose	multiple interactions	ISO	Slc6a7 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of SLC6A7 mRNA	CTD	PMID:37567420
Slc6a7	Rat	graphite	affects expression	EXP		6480464	Graphite affects the expression of SLC6A7 mRNA	CTD	PMID:29933104
Slc6a7	Rat	lead(0)	affects expression	ISO	SLC6A7 (Homo sapiens)	6480464	Lead affects the expression of SLC6A7 mRNA	CTD	PMID:28903495
Slc6a7	Rat	methylmercury chloride	decreases expression	ISO	Slc6a7 (Mus musculus)	6480464	methylmercuric chloride results in decreased expression of SLC6A7 mRNA	CTD	PMID:29261810
Slc6a7	Rat	morphine	decreases expression	ISO	Slc6a7 (Mus musculus)	6480464	Morphine results in decreased expression of SLC6A7 mRNA	CTD	PMID:21955143
Slc6a7	Rat	nicotine	decreases expression	ISO	Slc6a7 (Mus musculus)	6480464	Nicotine results in decreased expression of SLC6A7 mRNA	CTD	PMID:21955143
Slc6a7	Rat	Theaflavin 3,3'-digallate	affects expression	ISO	SLC6A7 (Homo sapiens)	6480464	theaflavin-3 and 3'-digallate affects the expression of SLC6A7 mRNA	CTD	PMID:34925699
Slc6a7	Rat	titanium dioxide	decreases methylation	ISO	Slc6a7 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of SLC6A7 gene	CTD	PMID:35295148
Slc6a7	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of SLC6A7 mRNA	CTD	PMID:33387578
Slc6a7	Rat	valproic acid	decreases expression	ISO	Slc6a7 (Mus musculus)	6480464	Valproic Acid results in decreased expression of SLC6A7 mRNA	CTD	PMID:29261810

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slc6a7	Rat	amino acid transport	involved_in	IEA	UniProtKB-KW:KW-0029	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Slc6a7	Rat	glycine import across plasma membrane	involved_in	IBA	FB:FBgn0267326 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Slc6a7	Rat	neurotransmitter transport	involved_in	IEA	UniProtKB-KW:KW-0532	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Slc6a7	Rat	proline transmembrane transport	acts_upstream_of_or_within	ISO	Slc6a7 (Mus musculus)	1624291	PMID:19029042	RGD	PMID:19029042
Slc6a7	Rat	proline transmembrane transport	acts_upstream_of_or_within	IEA	UniProtKB:Q6PGE7 and ensembl:ENSMUSP00000025520	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Slc6a7	Rat	proline transport		IDA		633816		RGD
Slc6a7	Rat	proline transport	involved_in	IBA	PANTHER:PTN002614390 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Slc6a7	Rat	proline transport	involved_in	ISO	SLC6A7 (Homo sapiens)	1624291	PMID:7651355	RGD	PMID:7651355
Slc6a7	Rat	proline transport	involved_in	IEA	UniProtKB:Q99884 and ensembl:ENSP00000230671	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Slc6a7	Rat	proline transport	involved_in	IDA		152025513	PMID:10414958	UniProt
Slc6a7	Rat	protein catabolic process	involved_in	IEA	UniProtKB:Q99884 and ensembl:ENSP00000230671	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Slc6a7	Rat	protein catabolic process	involved_in	ISO	SLC6A7 (Homo sapiens)	1624291	PMID:7651355	RGD	PMID:7651355
Slc6a7	Rat	protein catabolic process	involved_in	EXP		155230706	PMID:6286882	SynGO
Slc6a7	Rat	sodium ion transmembrane transport	involved_in	IBA	PANTHER:PTN000177662 and UniProtKB:P30531	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Slc6a7	Rat	transmembrane transport	involved_in	IEA	GO:0015293	1600115	GO_REF:0000108	GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slc6a7	Rat	glutamatergic synapse	is_active_in	IDA		13702417	PMID:9870934	SynGO
Slc6a7	Rat	glutamatergic synapse	is_active_in	IEP		13702417	PMID:9870934	SynGO
Slc6a7	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Slc6a7	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Slc6a7	Rat	membrane	located_in	IEA	InterPro:IPR000175	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Slc6a7	Rat	plasma membrane	is_active_in	IBA	FB:FBgn0011603 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Slc6a7	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Slc6a7	Rat	presynaptic membrane	is_active_in	IDA		13702417	PMID:9870934	SynGO
Slc6a7	Rat	Schaffer collateral - CA1 synapse	is_active_in	IDA		13702417	PMID:9870934	SynGO
Slc6a7	Rat	Schaffer collateral - CA1 synapse	is_active_in	IEP		13702417	PMID:9870934	SynGO
Slc6a7	Rat	synapse	is_active_in	EXP		155230706	PMID:6286882	SynGO
Slc6a7	Rat	synapse	is_active_in	IEA	UniProtKB:Q99884 and ensembl:ENSP00000230671	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Slc6a7	Rat	synapse	located_in	IEA	UniProtKB-KW:KW-0770	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Slc6a7	Rat	synapse	is_active_in	ISO	SLC6A7 (Homo sapiens)	1624291	PMID:7651355	RGD	PMID:7651355
Slc6a7	Rat	synaptic membrane	located_in	IEA	UniProtKB-SubCell:SL-0531	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Slc6a7	Rat	synaptic vesicle membrane	is_active_in	IDA		13702417	PMID:9870934	SynGO
Slc6a7	Rat	synaptic vesicle membrane	is_active_in	IEP		13702417	PMID:9870934	SynGO

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slc6a7	Rat	L-proline transmembrane transporter activity		IDA		633816		RGD
Slc6a7	Rat	L-proline transmembrane transporter activity	enables	ISO	Slc6a7 (Mus musculus)	1624291	PMID:19029042	RGD	PMID:19029042
Slc6a7	Rat	L-proline transmembrane transporter activity	enables	ISO	SLC6A7 (Homo sapiens)	1624291	PMID:7651355	RGD	PMID:7651355
Slc6a7	Rat	L-proline transmembrane transporter activity	enables	IEA	UniProtKB:Q99884 and ensembl:ENSP00000230671	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Slc6a7	Rat	L-proline transmembrane transporter activity	enables	IDA		152025513	PMID:10414958	UniProt
Slc6a7	Rat	L-proline transmembrane transporter activity	enables	IEA	UniProtKB:Q6PGE7 and ensembl:ENSMUSP00000025520	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Slc6a7	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Slc6a7	Rat	proline:sodium symporter activity	enables	IEA	UniProtKB:Q99884 and ensembl:ENSP00000230671	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Slc6a7	Rat	proline:sodium symporter activity	enables	IBA	PANTHER:PTN002614390 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Slc6a7	Rat	proline:sodium symporter activity	enables	ISO	SLC6A7 (Homo sapiens)	1624291	PMID:7651355	RGD	PMID:7651355
Slc6a7	Rat	proline:sodium symporter activity	enables	ISS	UniProtKB:Q99884	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Slc6a7	Rat	proline:sodium symporter activity	enables	IDA		152025513	PMID:10414958	UniProt
Slc6a7	Rat	symporter activity	enables	IEA	UniProtKB-KW:KW-0769	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

#	Reference Title	Reference Citation
1.	Molecular cloning and expression of a high affinity L-proline transporter expressed in putative glutamatergic pathways of rat brain.	Fremeau RT Jr, etal., Neuron 1992 May;8(5):915-26.
2.	L-proline and L-pipecolate induce enkephalin-sensitive currents in human embryonic kidney 293 cells transfected with the high-affinity mammalian brain L-proline transporter.	Galli A, etal., J Neurosci. 1999 Aug 1;19(15):6290-7.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	"On" and "off" responses of K+-induced synaptosomal proline release: involvement of the sodium pump.	Nickolson VJ, J Neurochem. 1982 Jan;38(1):289-92. doi: 10.1111/j.1471-4159.1982.tb10885.x.
7.	The mammalian brain high-affinity L-proline transporter is enriched preferentially in synaptic vesicles in a subpopulation of excitatory nerve terminals in rat forebrain.	Renick SE, etal., J Neurosci. 1999 Jan 1;19(1):21-33.
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:16458270	PMID:19029042

Slc6a7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	56,718,849 - 56,737,702 (-)	NCBI		GRCr8
mRatBN7.2	18	54,448,464 - 54,467,319 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	54,448,464 - 54,467,319 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	56,536,530 - 56,555,331 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	57,251,136 - 57,269,935 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	55,072,309 - 55,091,168 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	56,305,765 - 56,325,179 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	56,305,735 - 56,331,991 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	55,557,703 - 55,564,493 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	18	55,539,473 - 55,557,682 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	56,958,965 - 56,977,159 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	57,031,196 - 57,049,391 (-)	NCBI
Celera	18	52,602,558 - 52,620,980 (-)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

SLC6A7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	150,190,062 - 150,211,063 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	150,190,062 - 150,222,788 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	149,569,625 - 149,590,626 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	149,549,713 - 149,570,828 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	149,549,712 - 149,570,827	NCBI
Celera	5	145,650,900 - 145,672,027 (+)	NCBI		Celera
Cytogenetic Map	5	q32	ENTREZGENE
HuRef	5	144,717,577 - 144,738,751 (+)	NCBI		HuRef
CHM1_1	5	149,002,105 - 149,023,228 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	150,721,251 - 150,747,665 (+)	NCBI		T2T-CHM13v2.0

Slc6a7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	61,128,448 - 61,147,484 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	61,128,452 - 61,147,294 (-)	Ensembl		GRCm39 Ensembl
GRCm38	18	60,995,376 - 61,014,416 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	60,995,380 - 61,014,222 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	61,155,034 - 61,173,853 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	61,120,749 - 61,139,568 (-)	NCBI		MGSCv36	mm8
Celera	18	62,282,370 - 62,301,212 (-)	NCBI		Celera
Cytogenetic Map	18	E1	NCBI
cM Map	18	34.41	NCBI

Slc6a7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	4,314,067 - 4,332,665 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	4,314,090 - 4,332,659 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC6A7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	145,418,619 - 145,439,644 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	143,558,179 - 143,579,193 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	145,614,286 - 145,635,345 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	151,619,466 - 151,640,609 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	151,619,288 - 151,652,149 (+)	Ensembl	panpan1.1		panPan2

SLC6A7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	58,873,547 - 58,892,357 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	58,874,137 - 58,887,129 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	58,638,808 - 58,658,424 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	59,353,446 - 59,373,028 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	59,353,457 - 59,373,409 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	59,142,170 - 59,161,799 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	59,256,627 - 59,276,264 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	59,787,700 - 59,807,346 (-)	NCBI		UU_Cfam_GSD_1.0

Slc6a7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	143,135,063 - 143,156,683 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936504	4,709,583 - 4,730,219 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936504	4,709,539 - 4,730,583 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC6A7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	151,223,028 - 151,241,976 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	151,221,542 - 151,241,983 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	158,310,108 - 158,329,390 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC6A7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	52,799,847 - 52,820,745 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	52,800,358 - 52,820,732 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	24,896,351 - 24,917,248 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc6a7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624774	9,499,450 - 9,519,583 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624774	9,499,697 - 9,519,522 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Slc6a7
134 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	76
Count of miRNA genes:	68
Interacting mature miRNAs:	72
Transcripts:	ENSRNOT00000025209
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
1331730	Scl27	Serum cholesterol level QTL 27	3.826		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	18	52292875	59796643	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
1331736	Bp227	Blood pressure QTL 227	2.791		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	46718763	59796643	Rat
1300125	Rf26	Renal function QTL 26	3.2		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	18	52539863	65844950	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	43345022	83828827	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	61698465	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	46640675	83828827	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	46640675	83828827	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	29792965	74792965	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
61360	Eaey	Experimental allergic encephalomyelitis QTL y	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	18	46988939	60377753	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31359408	83218561	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	52539763	76104388	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	38192455	83192455	Rat
2293658	Bmd23	Bone mineral density QTL 23	7.3	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	18	51464733	63636873	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	52292875	73997283	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	29792965	74792965	Rat
1331752	Bw27	Body weight QTL 27	2.963		body mass (VT:0001259)	body weight (CMO:0000012)	18	52292875	65845095	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	29792965	74792965	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	52539763	76104388	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	52539763	76104388	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	48520044	83828827	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	52539763	76104388	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31271681	60377755	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	52539763	76104388	Rat
1331806	Bp229	Blood pressure QTL 229	4.36484		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718763	57867167	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	52539763	76104388	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	52539763	76104388	Rat
1331780	Bp238	Blood pressure QTL 238	3.269		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718763	59796643	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	51464733	83218561	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31359408	59796643	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	35870723	80870723	Rat
6903345	Bp349	Blood pressure QTL 349	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
6903347	Bp350	Blood pressure QTL 350	4.4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359530	59796478	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	46640675	83828827	Rat
6903349	Bp351	Blood pressure QTL 351	3.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	52539763	69140759	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
738005	Anxrr11	Anxiety related response QTL 11	3.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	18	30039813	75039813	Rat
6903351	Bp352	Blood pressure QTL 352	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	46718935	59796478	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31393320	77209694	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	29792965	74792965	Rat
1600375	Mcs22	Mammary carcinoma susceptibility QTL 22	3.3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	52539763	63933058	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	48520044	83828827	Rat
1598826	Anxrr20	Anxiety related response QTL 20	3.04		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	18	41432971	83828827	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31359408	70263868	Rat
7411719	Strs5	Sensitivity to stroke QTL 5	9.4		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	18	49999958	65845095	Rat

AW455934

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	54,448,076 - 54,448,203 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	56,305,910 - 56,306,036	NCBI	Rnor6.0
Rnor_5.0	18	55,539,086 - 55,539,212	UniSTS	Rnor5.0
RGSC_v3.4	18	56,958,578 - 56,958,704	UniSTS	RGSC3.4
Celera	18	52,602,171 - 52,602,297	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	8	45	106	43	43	14	20	14	6	151	87	87	36	59	29


RefSeq Transcripts	NM_053996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600833	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600834	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M88111	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025209 ⟹ ENSRNOP00000025209

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	54,449,049 - 54,463,268 (-)	Ensembl
Rnor_6.0 Ensembl	18	56,307,020 - 56,325,095 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085841 ⟹ ENSRNOP00000070592

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	54,448,464 - 54,467,319 (-)	Ensembl
Rnor_6.0 Ensembl	18	56,306,297 - 56,331,991 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000086464 ⟹ ENSRNOP00000070137

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	18	56,305,735 - 56,326,389 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000091220 ⟹ ENSRNOP00000074128

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	54,448,464 - 54,463,268 (-)	Ensembl
Rnor_6.0 Ensembl	18	56,306,297 - 56,331,991 (-)	Ensembl

RefSeq Acc Id:

NM_053996 ⟹ NP_446448

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	56,718,849 - 56,737,702 (-)	NCBI
mRatBN7.2	18	54,448,464 - 54,467,319 (-)	NCBI
Rnor_6.0	18	56,306,297 - 56,325,179 (-)	NCBI
Rnor_5.0	18	55,539,473 - 55,557,682 (-)	NCBI
RGSC_v3.4	18	56,958,965 - 56,977,159 (-)	RGD
Celera	18	52,602,558 - 52,620,980 (-)	RGD

Sequence:

show sequence

AAAGGCGCAGAGATAGGACCAGTGCTCGGCGCCCGCTTGGCTGGCTGACTGCGCTCTTGCAAGCACCGGTGCCAGCTCTCCAAGATGAAGAAGCTCCAGGAAGCTCACCTCCGCAAGCCTGTCACCCC
AGACCTGCTGATGACTCCCAGTGACCAGGGTGATGTGGACCTGGATGTAGACTTTGCAGCAGACAGAGGCAACTGGACGGGCAAGCTGGACTTCTTGCTGTCCTGCATCGGCTACTGTGTGGGCTTGG
GAAATGTCTGGCGGTTTCCCTATCGAGCCTACACCAATGGAGGCGGAGCCTTCCTCGTGCCCTACTTCCTCATGCTGGCCATCTGTGGCATCCCCCTCTTCTTTCTTGAGCTCTCCCTGGGCCAGTTC
TCCAGCCTGGGACCCCTGGCTGTCTGGAAAATCAGCCCCCTCTTCAAAGGTGCGGGTGCAGCCATGCTGCTCATCGTGGGCCTGGTGGCCATCTACTACAACATGATCATCGCCTACGTCCTCTTCTA
CCTCTTCGCCTCCCTCACCAGCAACCTGCCCTGGGAGCATTGCGGCAACTGGTGGAACACAGAACGCTGCCTGGAGCACAGAGGCCCCAAGGATGGCAACGGGGCACTGCCTCTTAACCTCAGCAGCA
CTGTCAGCCCCAGTGAGGAGTACTGGAGCCGATATGTCCTGCACATTCAGGGCAGCCAGGGCATCGGCCGACCCGGGGAGATTCGCTGGAACCTCTGCCTCTGCCTGCTGCTGGCCTGGGTCATCGTG
TTTCTCTGTATCCTGAAGGGGGTGAAGTCCTCGGGCAAGGTGGTGTATTTCACAGCCACCTTTCCCTACCTCATCCTGCTCATGCTCCTGGTTCGAGGAGTGACCCTTCCCGGGGCCTGGAAGGGCAT
CCAGTTCTATCTCACCCCCCAATTCCACCACCTGCTGTCTTCCAAGGTGTGGATTGAAGCTGCTCTTCAGATCTTCTACTCTCTAGGAGTGGGTTTTGGGGGTCTTCTCACCTTTGCCTCCTACAACA
CATTCCACCAGAACATCTACAGAGACACCTTCATTGTCACTCTGGGCAATGCCATCACCAGCATCCTGGCTGGTTTTGCTATCTTCTCGGTGCTGGGCTACATGTCGCAGGAGCTGGGTGTGCCTGTG
GACCAAGTGGCCAAAGCAGGCCCTGGCCTGGCCTTTGTTGTCTACCCACAGGCCATGACTATGTTGCCTCTGTCACCCTTCTGGTCCTTCCTCTTCTTCTTCATGCTTCTGACTCTTGGCCTCGATAG
CCAGTTTGCCTTTCTGGAAACCATAGTGACTGCAGTGACCGATGAGTTCCCATACTACCTACGGCCCAAGAAGGCAGTGTTCTCAGGCCTCATCTGTGTAGCCATGTACCTGATGGGACTGATCCTCA
CCACCGATGGGGGGATGTACTGGCTGGTCCTTCTGGATGACTACAGCGCCAGCTTCGGACTCATGGTGGTGGTGATTACCACATGCCTCGCTGTCACCCGGGTATACGGCATCCAGCGGTTTTGTCGT
GACATCCACATGATGCTGGGCTTCAAGCCAGGACTCTACTTCAGGGCCTGCTGGCTGTTTTTGTCTCCGGCCACACTCTTGGCCTTGCTGGTGTACAGTATCGTCAAGTACCAGCCCTCGGAATACGG
TAGCTATCGCTTCCCCGCCTGGGCCGAGCTGCTAGGCATCCTGATGGGCCTGCTCTCCTGCCTCATGATCCCAGCTGGCATGCTGGTAGCTGTGCTTCGAGAGGAGGGCTCGCTCTGGGAGCGACTTC
AGCAAGCCAGCCGTCCTGCTATAGACTGGGGCCCATCACTGGAAGAGAACCGGACGGGCATGTATGTGGCCACCCTGGCTGGGAGCCAGTCACCAAAACCACTGATGGTACACATGCGAAAATATGGG
GGCATCACCAGCTTCGAGAATACAGCCATTGAGGTGGACCGTGAGATCGCAGAGGAGGAAGAGGAGTCCATGATGTGAGACCAGACACCTCCAAACAGGAGGGCTGGTCGGGGCCTCCCCGTCTGTCC
CTTCCTTGGCCCACAGGGGATAGCTTTGTCTGTTGGGATTCTGACAGGCAATGGGAGGTTGCCATGGCAACGACAGTCCCCAGCCTAAGTCCCTCTTTGTGGCCTCTACATCTCCTGGAACCTCTAGA
TGGACATACATATACTAGGTAACCCATTCAAAGCTGAAACGATTCAGCTCAGCCCTCAGTTTGTGAGGGGGTGCGTTGAAGCCAGGGAGAGAAGAGCTGGACCAAGGTGACATGCCCAAGAGGACTTG
TTCCCAAGCCTCCTCCAGCCAGTCAACTCCCTTTCCCTTGGGGGAGCAAGCACCATATCTGACATCTTTGTTCAGACACTTTGACAAGATACATTTCCATACAAGCCAACTTTAAACCCCAGGTTCAG
GGTAGCGAGAACCTGGAGAGCCCCAAGGCCCTGGATATAGATAGAATGGCAGCGACCAAATTGGGTAGAAAAGTCTTTGTGGGTTCCTGTGTTAAGGCCAGTTTTCCCAGAAGAAGTGGGAGCTTTAG
GGCTGAGAGGTGTGAAAGATTGCAGAAGAGGCTAGAGGGAAGGTTTGCGGGTCAGAGCTGCCCCTGAGCCAGGAGGAGGCCCAACCTGCCAGAGCAGAGACCAGGAGGGGCTGGAGATTGTGGTGCTC
CCGGGTTATGAGAGGGAATAAAGACTCGCAGGG

hide sequence


Protein RefSeqs	NP_446448	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41541	(Get FASTA)	NCBI Sequence Viewer
	EDM14583	(Get FASTA)	NCBI Sequence Viewer
	EDM14584	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025209.4
	ENSRNOP00000070592
	ENSRNOP00000070592.1
	ENSRNOP00000074128.2
GenBank Protein	P28573	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446448 ⟸ NM_053996

- UniProtKB:

P28573 (UniProtKB/Swiss-Prot), A0A0G2JYB6 (UniProtKB/TrEMBL), A6IXF3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKKLQEAHLRKPVTPDLLMTPSDQGDVDLDVDFAADRGNWTGKLDFLLSCIGYCVGLGNVWRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGAAMLLIVGL
VAIYYNMIIAYVLFYLFASLTSNLPWEHCGNWWNTERCLEHRGPKDGNGALPLNLSSTVSPSEEYWSRYVLHIQGSQGIGRPGEIRWNLCLCLLLAWVIVFLCILKGVKSSGKVVYFTATFPYLILLM
LLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLGVGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAGPGLAFVVYPQAMTMLPLSPFW
SFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLRPKKAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQRFCRDIHMMLGFKPGLYFRACWLFLSPATLLA
LLVYSIVKYQPSEYGSYRFPAWAELLGILMGLLSCLMIPAGMLVAVLREEGSLWERLQQASRPAIDWGPSLEENRTGMYVATLAGSQSPKPLMVHMRKYGGITSFENTAIEVDREIAEEEEESMM

hide sequence

Ensembl Acc Id:

ENSRNOP00000074128 ⟸ ENSRNOT00000091220

Ensembl Acc Id:

ENSRNOP00000070592 ⟸ ENSRNOT00000085841

Ensembl Acc Id:

ENSRNOP00000070137 ⟸ ENSRNOT00000086464

Ensembl Acc Id:

ENSRNOP00000025209 ⟸ ENSRNOT00000025209

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P28573-F1-model_v2	AlphaFold	P28573	1-637	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-7350	BioCyc
Ensembl Genes	ENSRNOG00000018644	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025209.6	UniProtKB/TrEMBL
	ENSRNOT00000085841	ENTREZGENE
	ENSRNOT00000085841.2	UniProtKB/TrEMBL
	ENSRNOT00000091220.2	UniProtKB/TrEMBL
InterPro	Na/ntran_symport	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SNS_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:117100	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	117100	ENTREZGENE
PANTHER	PTHR11616	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SODIUM-DEPENDENT PROLINE TRANSPORTER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	SNF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Slc6a7	PhenoGen
PRINTS	NANEUSMPORT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	NA_NEUROTRAN_SYMP_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NA_NEUROTRAN_SYMP_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NA_NEUROTRAN_SYMP_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018644	RatGTEx
Superfamily-SCOP	SSF161070	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JYB6	ENTREZGENE, UniProtKB/TrEMBL
	A0A0G2K7A6_RAT	UniProtKB/TrEMBL
	A6IXF2_RAT	UniProtKB/TrEMBL
	A6IXF3	ENTREZGENE, UniProtKB/TrEMBL
	G3V8F1_RAT	UniProtKB/TrEMBL
	P28573	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Slc6a7	solute carrier family 6 member 7	LOC103690061	sodium-dependent proline transporter-like	Data merged from RGD:9125619	737654	PROVISIONAL
2016-02-24	Slc6a7	solute carrier family 6 member 7	Slc6a7	solute carrier family 6 (neurotransmitter transporter), member 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2014-08-25	LOC103690061	sodium-dependent proline transporter-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2013-08-02	Slc6a7	solute carrier family 6 (neurotransmitter transporter), member 7	Slc6a7	solute carrier family 6 (neurotransmitter transporter, L-proline), member 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-01-30	Slc6a7	solute carrier family 6 (neurotransmitter transporter, L-proline), member 7	Prot	proline transporter	Symbol and Name updated to reflect Human and Mouse nomenclature	625702	APPROVED
2002-08-07	Prot	proline transporter			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_expression	mRNA expression in mitral cells of the olfactory bulb, pyramidal cells of layer V of the cerebral cortex, pyramidal cells of the piriform cortex, and pyramidal cells of field CA3 of the hippocampus	633816

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar