Symbol:
Pfn1
Name:
profilin 1
RGD ID:
621825
Description:
Enables phosphatidylinositol-4,5-bisphosphate binding activity and signaling receptor binding activity. Involved in several processes, including positive regulation of nucleobase-containing compound metabolic process; positive regulation of stress fiber assembly; and positive regulation of viral transcription. Is active in several cellular components, including Schaffer collateral - CA1 synapse; parallel fiber to Purkinje cell synapse; and postsynapse. Used to study membranoproliferative glomerulonephritis. Human ortholog(s) of this gene implicated in amyotrophic lateral sclerosis type 18. Orthologous to human PFN1 (profilin 1); INTERACTS WITH (S)-nicotine; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dibromophenyl 2,4,5-tribromophenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
profilin; profilin I; profilin-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PFN1 (profilin 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Pfn1 (profilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pfn1 (profilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PFN1 (profilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PFN1 (profilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pfn1 (profilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PFN1 (profilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PFN1 (profilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pfn1 (profilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PFN2 (profilin 2) HGNC
OrthoDB
Homo sapiens (human):
DPPA2 (developmental pluripotency associated 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PFN1 (profilin 1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Pfn1 (profilin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pfn1
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 55,863,882 - 55,866,587 (-) NCBI GRCr8 mRatBN7.2 10 55,365,263 - 55,367,968 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 55,365,262 - 55,527,631 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 60,045,873 - 60,048,577 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 59,534,379 - 59,537,083 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 55,033,485 - 55,036,189 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 57,273,003 - 57,275,708 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 57,273,005 - 57,275,708 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 57,018,597 - 57,021,302 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 57,531,661 - 57,534,366 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 57,545,285 - 57,547,989 (-) NCBI Celera 10 54,510,819 - 54,513,524 (-) NCBI Celera RH 3.4 Map 9 783.99 RGD Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pfn1 Rat (-)-epigallocatechin 3-gallate increases expression ISO PFN1 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of PFN1 protein CTD PMID:31195006 Pfn1 Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of PFN1 mRNA CTD PMID:11478936 Pfn1 Rat 1,2-dimethylhydrazine increases expression ISO Pfn1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PFN1 mRNA CTD PMID:22206623 Pfn1 Rat 1,2-dimethylhydrazine multiple interactions ISO Pfn1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of PFN1 mRNA] CTD PMID:22206623 Pfn1 Rat 17alpha-ethynylestradiol multiple interactions ISO Pfn1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PFN1 mRNA CTD PMID:17942748 Pfn1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pfn1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PFN1 mRNA CTD PMID:17942748 Pfn1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PFN1 mRNA CTD PMID:34747641 Pfn1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pfn1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PFN1 mRNA CTD PMID:21570461 Pfn1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2 more ... CTD PMID:19954255 Pfn1 Rat 2,6-dimethoxyphenol multiple interactions ISO PFN1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of and affects the localization of PFN1 protein CTD PMID:38598786 Pfn1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PFN1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PFN1 mRNA CTD PMID:28628672 Pfn1 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PFN1 mRNA CTD PMID:25380136 Pfn1 Rat 4,4'-sulfonyldiphenol increases expression ISO PFN1 (Homo sapiens) 6480464 bisphenol S results in increased expression of PFN1 protein CTD PMID:34186270 Pfn1 Rat 4,4'-sulfonyldiphenol increases expression ISO Pfn1 (Mus musculus) 6480464 bisphenol S results in increased expression of PFN1 mRNA CTD PMID:37611474 and PMID:39298647 Pfn1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Pfn1 (Mus musculus) 6480464 bisphenol S affects the methylation of PFN1 gene CTD PMID:31683443 Pfn1 Rat 5-azacytidine increases expression ISO PFN1 (Homo sapiens) 6480464 Azacitidine results in increased expression of PFN1 mRNA CTD PMID:20823114 Pfn1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PFN1 mRNA CTD PMID:30047161 Pfn1 Rat acetylsalicylic acid decreases expression ISO PFN1 (Homo sapiens) 6480464 Aspirin results in decreased expression of PFN1 mRNA CTD PMID:15928584 Pfn1 Rat actinomycin D multiple interactions ISO PFN1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PFN1 protein CTD PMID:38460933 Pfn1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PFN1 mRNA CTD PMID:23630614 Pfn1 Rat aflatoxin B1 increases expression ISO PFN1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of PFN1 mRNA CTD PMID:27153756 Pfn1 Rat all-trans-retinoic acid increases expression ISO PFN1 (Homo sapiens) 6480464 Tretinoin results in increased expression of PFN1 mRNA and Tretinoin results in increased expression of PFN1 protein CTD PMID:17051635 more ... Pfn1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PFN1 mRNA CTD PMID:30047161 Pfn1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PFN1 mRNA CTD PMID:16483693 Pfn1 Rat ampicillin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PFN1 protein CTD PMID:30545405 Pfn1 Rat aristolochic acid A increases expression ISO PFN1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PFN1 protein CTD PMID:33212167 Pfn1 Rat Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of PFN1 mRNA CTD PMID:18178546 Pfn1 Rat arsenite(3-) multiple interactions ISO PFN1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to PFN1 mRNA] and arsenite promotes the reaction [G3BP1 protein binds to PFN1 protein] CTD PMID:32406909 Pfn1 Rat atrazine decreases expression ISO PFN1 (Homo sapiens) 6480464 Atrazine results in decreased expression of PFN1 mRNA and Atrazine results in decreased expression of PFN1 protein CTD PMID:25275270 Pfn1 Rat atrazine increases expression ISO PFN1 (Homo sapiens) 6480464 Atrazine results in increased expression of PFN1 mRNA CTD PMID:22378314 Pfn1 Rat beauvericin decreases expression ISO PFN1 (Homo sapiens) 6480464 beauvericin results in decreased expression of PFN1 mRNA CTD PMID:29203277 Pfn1 Rat beauvericin multiple interactions ISO PFN1 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in increased expression of PFN1 protein CTD PMID:32407736 Pfn1 Rat benzatropine increases expression ISO PFN1 (Homo sapiens) 6480464 Benztropine results in increased expression of PFN1 protein CTD PMID:34122009 Pfn1 Rat benzo[a]pyrene decreases expression ISO PFN1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PFN1 mRNA CTD PMID:20106945 Pfn1 Rat benzo[a]pyrene multiple interactions ISO PFN1 (Homo sapiens) 6480464 PARG affects the reaction [Benzo(a)pyrene results in increased expression of PFN1 protein] CTD PMID:25628927 Pfn1 Rat benzo[a]pyrene increases expression ISO PFN1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PFN1 protein CTD PMID:25628927 Pfn1 Rat benzo[a]pyrene increases expression ISO Pfn1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PFN1 mRNA CTD PMID:22228805 Pfn1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Pfn1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PFN1 mRNA CTD PMID:38008054 Pfn1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Pfn1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PFN1 mRNA CTD PMID:33754040 Pfn1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PFN1 mRNA CTD PMID:25181051 and PMID:32145629 Pfn1 Rat bisphenol A multiple interactions ISO Pfn1 (Mus musculus) 6480464 [Dextran Sulfate co-treated with bisphenol A] results in decreased expression of PFN1 protein CTD PMID:35999755 Pfn1 Rat bisphenol A decreases expression ISO Pfn1 (Mus musculus) 6480464 bisphenol A results in decreased expression of PFN1 mRNA and bisphenol A results in decreased expression of PFN1 protein CTD PMID:33221593 and PMID:35999755 Pfn1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PFN1 mRNA CTD PMID:30816183 Pfn1 Rat bisphenol A affects expression ISO PFN1 (Homo sapiens) 6480464 bisphenol A affects the expression of PFN1 mRNA CTD PMID:30903817 Pfn1 Rat bisphenol A multiple interactions ISO PFN1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PFN1 mRNA CTD PMID:28628672 Pfn1 Rat bisphenol AF increases expression ISO PFN1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PFN1 protein CTD PMID:34186270 Pfn1 Rat cadmium atom multiple interactions ISO PFN1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PFN1 protein CTD PMID:33040242 Pfn1 Rat cadmium dichloride multiple interactions ISO PFN1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PFN1 protein CTD PMID:33040242 Pfn1 Rat cadmium dichloride increases expression ISO PFN1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PFN1 mRNA CTD PMID:38568856 Pfn1 Rat caffeine decreases phosphorylation ISO PFN1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PFN1 protein CTD PMID:35688186 Pfn1 Rat captan increases expression ISO Pfn1 (Mus musculus) 6480464 Captan results in increased expression of PFN1 mRNA CTD PMID:31558096 Pfn1 Rat carbon nanotube affects expression ISO PFN1 (Homo sapiens) 6480464 Nanotubes and Carbon affects the expression of PFN1 protein CTD PMID:22001959 Pfn1 Rat carbon nanotube increases expression ISO Pfn1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Pfn1 Rat carbon nanotube increases expression ISO PFN1 (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of PFN1 protein CTD PMID:22157353 Pfn1 Rat carmustine decreases expression ISO PFN1 (Homo sapiens) 6480464 Carmustine results in decreased expression of PFN1 mRNA CTD PMID:15980968 Pfn1 Rat chloropicrin decreases expression ISO PFN1 (Homo sapiens) 6480464 chloropicrin results in decreased expression of PFN1 mRNA CTD PMID:26352163 Pfn1 Rat chlorpyrifos increases expression ISO Pfn1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PFN1 mRNA CTD PMID:37019170 Pfn1 Rat clobetasol increases expression ISO Pfn1 (Mus musculus) 6480464 Clobetasol results in increased expression of PFN1 mRNA CTD PMID:27462272 Pfn1 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PFN1 mRNA CTD PMID:17602206 Pfn1 Rat cobalt dichloride decreases expression ISO PFN1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PFN1 mRNA CTD PMID:19320972 Pfn1 Rat cocaine increases expression ISO PFN1 (Homo sapiens) 6480464 Cocaine results in increased expression of PFN1 mRNA CTD PMID:12629581 Pfn1 Rat copper atom affects binding ISO PFN1 (Homo sapiens) 6480464 PFN1 protein binds to Copper CTD PMID:14534351 Pfn1 Rat copper(0) affects binding ISO PFN1 (Homo sapiens) 6480464 PFN1 protein binds to Copper CTD PMID:14534351 Pfn1 Rat CU-O LINKAGE decreases expression ISO PFN1 (Homo sapiens) 6480464 cupric oxide results in decreased expression of PFN1 protein CTD PMID:25470785 Pfn1 Rat dexamethasone multiple interactions ISO PFN1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PFN1 mRNA CTD PMID:28628672 Pfn1 Rat dextran sulfate decreases expression ISO Pfn1 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of PFN1 protein CTD PMID:35999755 Pfn1 Rat dextran sulfate multiple interactions ISO Pfn1 (Mus musculus) 6480464 [Dextran Sulfate co-treated with bisphenol A] results in decreased expression of PFN1 protein CTD PMID:35999755 Pfn1 Rat Dibutyl phosphate affects expression ISO PFN1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PFN1 mRNA CTD PMID:37042841 Pfn1 Rat dihydroartemisinin affects binding ISO PFN1 (Homo sapiens) 6480464 artenimol analog binds to PFN1 protein CTD PMID:26340163 Pfn1 Rat diuron decreases expression ISO PFN1 (Homo sapiens) 6480464 Diuron results in decreased expression of PFN1 mRNA CTD PMID:35967413 Pfn1 Rat doxorubicin affects expression ISO PFN1 (Homo sapiens) 6480464 Doxorubicin affects the expression of PFN1 protein CTD PMID:29385562 Pfn1 Rat elemental selenium multiple interactions ISO PFN1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of PFN1 mRNA CTD PMID:19244175 Pfn1 Rat elemental selenium increases expression ISO PFN1 (Homo sapiens) 6480464 Selenium results in increased expression of PFN1 mRNA CTD PMID:19244175 Pfn1 Rat enniatin multiple interactions ISO PFN1 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in increased expression of PFN1 protein CTD PMID:32407736 Pfn1 Rat enzyme inhibitor multiple interactions ISO PFN1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PFN1 protein CTD PMID:23301498 Pfn1 Rat epoxiconazole decreases expression ISO Pfn1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of PFN1 mRNA CTD PMID:35436446 Pfn1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PFN1 mRNA CTD PMID:24136188 Pfn1 Rat folic acid multiple interactions ISO Pfn1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of PFN1 mRNA] CTD PMID:22206623 Pfn1 Rat folpet increases expression ISO Pfn1 (Mus musculus) 6480464 folpet results in increased expression of PFN1 mRNA CTD PMID:31558096 Pfn1 Rat FR900359 decreases phosphorylation ISO PFN1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of PFN1 protein CTD PMID:37730182 Pfn1 Rat furfural multiple interactions ISO PFN1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PFN1 protein CTD PMID:38598786 Pfn1 Rat genistein increases expression ISO Pfn1 (Mus musculus) 6480464 Genistein results in increased expression of PFN1 mRNA CTD PMID:16169203 Pfn1 Rat gentamycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PFN1 protein CTD PMID:30545405 Pfn1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PFN1 mRNA CTD PMID:33387578 Pfn1 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of PFN1 mRNA CTD PMID:24136188 Pfn1 Rat graphite increases expression ISO PFN1 (Homo sapiens) 6480464 Graphite results in increased expression of PFN1 protein CTD PMID:22157353 Pfn1 Rat haloperidol increases expression ISO PFN1 (Homo sapiens) 6480464 Haloperidol results in increased expression of PFN1 protein CTD PMID:34122009 Pfn1 Rat hydralazine multiple interactions ISO PFN1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PFN1 mRNA CTD PMID:17183730 Pfn1 Rat hydrogen peroxide increases expression ISO PFN1 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of PFN1 protein CTD PMID:34581912 Pfn1 Rat indometacin multiple interactions ISO PFN1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of PFN1 mRNA CTD PMID:28628672 Pfn1 Rat ivermectin decreases expression ISO PFN1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PFN1 protein CTD PMID:32959892 Pfn1 Rat malathion decreases expression ISO PFN1 (Homo sapiens) 6480464 Malathion results in decreased expression of PFN1 mRNA CTD PMID:32069766 Pfn1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PFN1 mRNA CTD PMID:30047161 Pfn1 Rat methyl methanesulfonate decreases expression ISO PFN1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of PFN1 mRNA CTD PMID:23649840 Pfn1 Rat metronidazole multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PFN1 protein CTD PMID:30545405 Pfn1 Rat microcystin-LR decreases expression ISO Pfn1 (Mus musculus) 6480464 cyanoginosin LR results in decreased expression of PFN1 mRNA CTD PMID:17383702 Pfn1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PFN1 mRNA CTD PMID:17602206 Pfn1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PFN1 mRNA CTD PMID:24136188 Pfn1 Rat neomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PFN1 protein CTD PMID:30545405 Pfn1 Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of PFN1 mRNA CTD PMID:11478936 Pfn1 Rat nitrates multiple interactions ISO Pfn1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PFN1 mRNA CTD PMID:35964746 Pfn1 Rat Nutlin-3 multiple interactions ISO PFN1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PFN1 protein CTD PMID:38460933 Pfn1 Rat ouabain affects expression ISO PFN1 (Homo sapiens) 6480464 Ouabain affects the expression of PFN1 protein CTD PMID:17268060 Pfn1 Rat ouabain decreases expression ISO PFN1 (Homo sapiens) 6480464 Ouabain results in decreased expression of PFN1 protein CTD PMID:18247327 Pfn1 Rat ozone increases expression ISO Pfn1 (Mus musculus) 6480464 Ozone results in increased expression of PFN1 mRNA and Ozone results in increased expression of PFN1 protein CTD PMID:16183385 Pfn1 Rat ozone multiple interactions ISO Pfn1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PFN1 mRNA CTD PMID:34911549 Pfn1 Rat paracetamol affects expression ISO Pfn1 (Mus musculus) 6480464 Acetaminophen affects the expression of PFN1 mRNA CTD PMID:17562736 Pfn1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PFN1 mRNA CTD PMID:33387578 Pfn1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO Pfn1 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of PFN1 protein CTD PMID:26178269 Pfn1 Rat perfluorooctanoic acid increases expression ISO Pfn1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of PFN1 protein CTD PMID:28126411 Pfn1 Rat phenobarbital increases expression ISO Pfn1 (Mus musculus) 6480464 Phenobarbital results in increased expression of PFN1 mRNA CTD PMID:19270015 Pfn1 Rat phenobarbital affects expression ISO Pfn1 (Mus musculus) 6480464 Phenobarbital affects the expression of PFN1 mRNA CTD PMID:23091169 Pfn1 Rat pirinixic acid multiple interactions ISO PFN1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of PFN1 mRNA CTD PMID:19710929 Pfn1 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of PFN1 mRNA CTD PMID:30047161 Pfn1 Rat quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of PFN1 protein CTD PMID:18095365 Pfn1 Rat quercetin increases expression ISO PFN1 (Homo sapiens) 6480464 Quercetin results in increased expression of PFN1 protein CTD PMID:14750173 Pfn1 Rat rotenone increases expression ISO PFN1 (Homo sapiens) 6480464 Rotenone results in increased expression of PFN1 mRNA CTD PMID:33512557 Pfn1 Rat selenium atom multiple interactions ISO PFN1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of PFN1 mRNA CTD PMID:19244175 Pfn1 Rat selenium atom increases expression ISO PFN1 (Homo sapiens) 6480464 Selenium results in increased expression of PFN1 mRNA CTD PMID:19244175 Pfn1 Rat silicon dioxide affects secretion ISO PFN1 (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of PFN1 protein CTD PMID:25895662 Pfn1 Rat sodium arsenite increases expression ISO Pfn1 (Mus musculus) 6480464 sodium arsenite results in increased expression of PFN1 protein CTD PMID:29044176 Pfn1 Rat sodium arsenite increases expression ISO PFN1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PFN1 mRNA CTD PMID:34032870 Pfn1 Rat sodium chloride multiple interactions ISO PFN1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PFN1 protein more ... CTD PMID:38598786 Pfn1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of PFN1 mRNA CTD PMID:25993096 Pfn1 Rat sodium dichromate increases expression ISO Pfn1 (Mus musculus) 6480464 sodium bichromate results in increased expression of PFN1 mRNA CTD PMID:31558096 Pfn1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of PFN1 mRNA CTD PMID:30047161 Pfn1 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of PFN1 protein CTD PMID:26141394 Pfn1 Rat tanespimycin increases expression ISO PFN1 (Homo sapiens) 6480464 tanespimycin analog results in increased expression of PFN1 protein CTD PMID:31370342 Pfn1 Rat tetrachloromethane increases expression ISO Pfn1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PFN1 mRNA CTD PMID:31919559 Pfn1 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of PFN1 protein CTD PMID:35544339 Pfn1 Rat thimerosal decreases expression ISO PFN1 (Homo sapiens) 6480464 Thimerosal results in decreased expression of PFN1 mRNA CTD PMID:27188386 Pfn1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PFN1 mRNA CTD PMID:34492290 Pfn1 Rat titanium dioxide decreases phosphorylation ISO PFN1 (Homo sapiens) 6480464 titanium dioxide results in decreased phosphorylation of PFN1 protein CTD PMID:21439344 Pfn1 Rat titanium dioxide decreases methylation ISO Pfn1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PFN1 gene and titanium dioxide results in decreased methylation of PFN1 promoter alternative form CTD PMID:35295148 Pfn1 Rat titanium dioxide increases methylation ISO Pfn1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of PFN1 gene CTD PMID:35295148 Pfn1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of PFN1 mRNA CTD PMID:33387578 Pfn1 Rat triphenyl phosphate affects expression ISO PFN1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PFN1 mRNA CTD PMID:37042841 Pfn1 Rat triphenyl phosphate increases expression ISO PFN1 (Homo sapiens) 6480464 triphenyl phosphate results in increased expression of PFN1 mRNA CTD PMID:35776891 Pfn1 Rat triphenylstannane decreases expression ISO PFN1 (Homo sapiens) 6480464 triphenyltin analog results in decreased expression of PFN1 protein CTD PMID:31634547 Pfn1 Rat valproic acid multiple interactions ISO PFN1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PFN1 mRNA CTD PMID:17183730 Pfn1 Rat vancomycin decreases expression ISO Pfn1 (Mus musculus) 6480464 Vancomycin results in decreased expression of PFN1 mRNA CTD PMID:18930951 Pfn1 Rat vancomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PFN1 protein CTD PMID:30545405 Pfn1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PFN1 mRNA CTD PMID:23034163 Pfn1 Rat vitamin E increases expression ISO PFN1 (Homo sapiens) 6480464 Vitamin E results in increased expression of PFN1 mRNA CTD PMID:19244175 Pfn1 Rat vitamin E multiple interactions ISO PFN1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in increased expression of PFN1 mRNA CTD PMID:19244175
(-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,6-dimethoxyphenol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 5-azacytidine (ISO) 6-propyl-2-thiouracil (EXP) acetylsalicylic acid (ISO) actinomycin D (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) ampicillin (EXP) aristolochic acid A (ISO) Aroclor 1254 (EXP) arsenite(3-) (ISO) atrazine (ISO) beauvericin (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) captan (ISO) carbon nanotube (ISO) carmustine (ISO) chloropicrin (ISO) chlorpyrifos (ISO) clobetasol (ISO) clofibric acid (EXP) cobalt dichloride (ISO) cocaine (ISO) copper atom (ISO) copper(0) (ISO) CU-O LINKAGE (ISO) dexamethasone (ISO) dextran sulfate (ISO) Dibutyl phosphate (ISO) dihydroartemisinin (ISO) diuron (ISO) doxorubicin (ISO) elemental selenium (ISO) enniatin (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) flutamide (EXP) folic acid (ISO) folpet (ISO) FR900359 (ISO) furfural (ISO) genistein (ISO) gentamycin (EXP) glafenine (EXP) graphite (ISO) haloperidol (ISO) hydralazine (ISO) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) malathion (ISO) methimazole (EXP) methyl methanesulfonate (ISO) metronidazole (EXP) microcystin-LR (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) neomycin (EXP) nicotine (EXP) nitrates (ISO) Nutlin-3 (ISO) ouabain (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) propiconazole (EXP) quercetin (EXP,ISO) rotenone (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP,ISO) sulfadimethoxine (EXP) T-2 toxin (EXP) tanespimycin (ISO) tetrachloromethane (ISO) thapsigargin (EXP) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) triphenylstannane (ISO) valproic acid (ISO) vancomycin (EXP,ISO) vinclozolin (EXP) vitamin E (ISO)
Molecular Function
actin binding (IBA,IEA,ISO,TAS) actin monomer binding (IEA,ISO) adenyl-nucleotide exchange factor activity (IEA,ISO) phosphatidylinositol-4,5-bisphosphate binding (IDA,IEA,ISO) phosphotyrosine residue binding (IEA,ISO) proline-rich region binding (IEA,ISO) protein binding (IPI,ISO) signaling receptor binding (IDA) small GTPase binding (ISO)
1.
Profilin is required for viral morphogenesis, syncytium formation, and cell-specific stress fiber induction by respiratory syncytial virus.
Bitko V, etal., BMC Microbiol. 2003 May 9;3:9.
2.
Endothelin-1 mobilizes profilin-1-bound PIP2 in cardiac muscle.
Evans NJ and Walker JW, Exp Biol Med (Maywood). 2006 Jun;231(6):882-7.
3.
Location of profilin at presynaptic sites in the cerebellar cortex; implication for the regulation of the actin-polymerization state during axonal elongation and synaptogenesis.
Faivre-Sarrailh C, etal., J Neurocytol. 1993 Dec;22(12):1060-72.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Complex formation between the postsynaptic scaffolding protein gephyrin, profilin, and Mena: a possible link to the microfilament system.
Giesemann T, etal., J Neurosci. 2003 Sep 10;23(23):8330-9.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Biomarker discovery from pancreatic cancer secretome using a differential proteomic approach.
Gronborg M, etal., Mol Cell Proteomics. 2006 Jan;5(1):157-71. Epub 2005 Oct 8.
8.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Increase of hepatic mRNAS of profilin, actin and extracellular matrix proteins after carbon tetrachloride treatment and partial hepatectomy in rats.
Nakamura H, etal., Biochem Biophys Res Commun. 1994 Jan 28;198(2):568-73.
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
The actin-binding protein profilin I is localized at synaptic sites in an activity-regulated manner.
Neuhoff H, etal., Eur J Neurosci. 2005 Jan;21(1):15-25. doi: 10.1111/j.1460-9568.2004.03814.x.
13.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
14.
GOA pipeline
RGD automated data pipeline
15.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
18.
Enhanced glomerular profilin gene and protein expression in experimental mesangial proliferative glomerulonephritis.
Tamura M, etal., Biochem Biophys Res Commun 1996 May 24;222(3):683-7.
19.
Expression of profilin, an actin-binding protein, in rat experimental glomerulonephritis and its upregulation by basic fibroblast growth factor in cultured rat mesangial cells.
Tamura M, etal., J Am Soc Nephrol. 2000 Mar;11(3):423-33.
20.
Activation of DNA synthesis and AP-1 by profilin, an actin-binding protein, via binding to a cell surface receptor in cultured rat mesangial cells.
Tamura M, etal., J Am Soc Nephrol. 2000 Sep;11(9):1620-30.
Pfn1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 55,863,882 - 55,866,587 (-) NCBI GRCr8 mRatBN7.2 10 55,365,263 - 55,367,968 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 55,365,262 - 55,527,631 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 60,045,873 - 60,048,577 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 59,534,379 - 59,537,083 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 55,033,485 - 55,036,189 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 57,273,003 - 57,275,708 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 57,273,005 - 57,275,708 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 57,018,597 - 57,021,302 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 57,531,661 - 57,534,366 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 57,545,285 - 57,547,989 (-) NCBI Celera 10 54,510,819 - 54,513,524 (-) NCBI Celera RH 3.4 Map 9 783.99 RGD Cytogenetic Map 10 q24 NCBI
PFN1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 4,945,652 - 4,948,530 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 4,945,652 - 4,949,061 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 4,848,947 - 4,851,825 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 4,789,692 - 4,792,570 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 4,789,693 - 4,792,570 NCBI Celera 17 4,863,758 - 4,866,636 (-) NCBI Celera Cytogenetic Map 17 p13.2 NCBI HuRef 17 4,736,535 - 4,739,971 (-) NCBI HuRef CHM1_1 17 4,858,279 - 4,861,714 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 4,836,000 - 4,838,878 (-) NCBI T2T-CHM13v2.0
Pfn1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 70,542,670 - 70,547,625 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 70,542,676 - 70,545,470 (-) Ensembl GRCm39 Ensembl GRCm38 11 70,651,844 - 70,656,799 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 70,651,850 - 70,654,644 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 70,465,349 - 70,468,152 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 70,468,044 - 70,470,830 (-) NCBI MGSCv36 mm8 Celera 11 78,202,791 - 78,205,594 (-) NCBI Celera Cytogenetic Map 11 B3 NCBI cM Map 11 43.21 NCBI
Pfn1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955467 10,357,838 - 10,360,651 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955467 10,357,838 - 10,360,651 (-) NCBI ChiLan1.0 ChiLan1.0
PFN1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 12,555,720 - 12,559,224 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 14,524,079 - 14,526,976 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 4,993,853 - 4,996,811 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 4,981,765 - 4,984,676 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 4,981,765 - 4,985,022 (-) Ensembl panpan1.1 panPan2
PFN1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 31,670,483 - 31,671,891 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 31,670,194 - 31,671,895 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 31,807,352 - 31,810,011 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 31,772,763 - 31,775,424 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 31,772,755 - 31,775,415 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 31,739,303 - 31,741,962 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 31,699,008 - 31,701,668 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 31,875,384 - 31,878,044 (+) NCBI UU_Cfam_GSD_1.0
Pfn1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 53,134,909 - 53,137,871 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936677 2,762,971 - 2,766,149 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936677 2,762,971 - 2,766,038 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PFN1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 51,961,952 - 51,965,464 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 51,962,642 - 51,965,570 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 54,031,353 - 54,034,283 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PFN1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 4,426,853 - 4,430,259 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 4,426,962 - 4,429,713 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 17,203,582 - 17,206,997 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pfn1
.
Predicted Target Of
Count of predictions: 283 Count of miRNA genes: 164 Interacting mature miRNAs: 182 Transcripts: ENSRNOT00000005370 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1578762 Toxo1 Toxoplasma gondii resistance QTL 1 brain integrity trait (VT:0010579) percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028) 10 52200030 59378278 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 1354585 Eae18a Experimental allergic encephalomyelitis QTL 18a 7.5 0.0004 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 10 53797385 58445852 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 2298495 Eae23 Experimental allergic encephalomyelitis QTL 23 16.93 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis duration (CMO:0001424) 10 55273696 60677262 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
AV328608
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 55,364,779 - 55,364,876 (+) MAPPER mRatBN7.2 Rnor_6.0 10 57,272,520 - 57,272,616 NCBI Rnor6.0 Rnor_5.0 10 57,018,114 - 57,018,210 UniSTS Rnor5.0 RGSC_v3.4 10 57,531,178 - 57,531,274 UniSTS RGSC3.4 Celera 10 54,510,336 - 54,510,432 UniSTS Cytogenetic Map 10 q24 UniSTS
RH94647
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 9 783.99 UniSTS Cytogenetic Map 10 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005370 ⟹ ENSRNOP00000005370
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 55,365,263 - 55,527,631 (-) Ensembl Rnor_6.0 Ensembl 10 57,273,005 - 57,275,708 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104684 ⟹ ENSRNOP00000093393
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 55,365,262 - 55,370,492 (-) Ensembl
RefSeq Acc Id:
NM_022511 ⟹ NP_071956
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 55,863,882 - 55,866,587 (-) NCBI mRatBN7.2 10 55,365,263 - 55,367,968 (-) NCBI Rnor_6.0 10 57,273,003 - 57,275,708 (-) NCBI Rnor_5.0 10 57,018,597 - 57,021,302 (-) NCBI RGSC_v3.4 10 57,531,661 - 57,534,366 (-) RGD Celera 10 54,510,819 - 54,513,524 (-) RGD
Sequence:
CAGCCGCGTTCCGGACGGCAGCGCGTGCCCCGAGCTCTCTGCCTTCCCCCGCCCGTCAGCCCGAGCCCAGCCCGCGATCCCAGCAGCAGCCCGCAGAGCAGCCCCAGCAGCAGCGCCATGGCCGGGTG
hide sequence
RefSeq Acc Id:
NP_071956 ⟸ NM_022511
- UniProtKB:
P62963 (UniProtKB/Swiss-Prot), A6HG86 (UniProtKB/TrEMBL)
- Sequence:
MAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVHGGLINKKC
hide sequence
Ensembl Acc Id:
ENSRNOP00000005370 ⟸ ENSRNOT00000005370
Ensembl Acc Id:
ENSRNOP00000093393 ⟸ ENSRNOT00000104684
RGD ID: 13697372 Promoter ID: EPDNEW_R7895 Type: initiation region Name: Pfn1_1 Description: profilin 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 57,275,741 - 57,275,801 EPDNEW
BioCyc Gene G2FUF-24439 BioCyc
Ensembl Genes ENSRNOG00000003975 Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000005370.7 UniProtKB/Swiss-Prot
ENSRNOT00000104684.1 UniProtKB/TrEMBL
Gene3D-CATH Dynein light chain 2a, cytoplasmic UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:5623232 IMAGE-MGC_LOAD
InterPro PFN UniProtKB/Swiss-Prot
PFN UniProtKB/Swiss-Prot
PFN UniProtKB/TrEMBL
PFN UniProtKB/TrEMBL
PFN_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Profilin1/2/3_vertebrate UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Profilin_CS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:64303 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE MGC:72445 IMAGE-MGC_LOAD
NCBI Gene 64303 ENTREZGENE
PANTHER PROFILIN UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PTHR13936:SF14 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam Profilin UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Pfn1 PhenoGen
PRINTS PROFILINMAML UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE PROFILIN UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000003975 RatGTEx
SMART PROF UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP SSF55770 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A8I6AKB2_RAT UniProtKB/TrEMBL
A6HG80_RAT UniProtKB/TrEMBL
A6HG83_RAT UniProtKB/TrEMBL
A6HG86 ENTREZGENE, UniProtKB/TrEMBL
P62963 ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary P10924 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Pfn1
profilin 1
profilin
Name updated
1299863 APPROVED
2002-08-07
Pfn1
profilin
Symbol and Name status set to provisional
70820 PROVISIONAL
