Symbol:
Rims3
Name:
regulating synaptic membrane exocytosis 3
RGD ID:
628762
Description:
Predicted to enable transmembrane transporter binding activity. Predicted to be a structural constituent of presynaptic active zone. Involved in calcium-ion regulated exocytosis and regulation of synapse organization. Acts upstream of or within regulation of synaptic vesicle exocytosis. Is active in glutamatergic synapse and postsynaptic cytosol. Orthologous to human RIMS3 (regulating synaptic membrane exocytosis 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Nim2; Nim3; rab-3-interacting molecule 3; regulating synaptic membrane exocytosis protein 3; RIM 3; RIM3 gamma
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 139,714,302 - 139,754,145 (+) NCBI GRCr8 mRatBN7.2 5 134,429,092 - 134,468,935 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 134,435,829 - 134,640,489 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 137,156,405 - 137,196,267 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 138,912,890 - 138,952,753 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 138,933,480 - 138,973,342 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 139,790,395 - 139,819,014 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 139,783,951 - 139,819,016 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 143,583,599 - 143,612,218 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 141,449,059 - 141,477,301 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 141,454,284 - 141,482,527 (+) NCBI Celera 5 132,990,363 - 133,018,593 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rims3 Rat 1,2-dichloroethane decreases expression ISO Rims3 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of RIMS3 mRNA CTD PMID:28960355 Rims3 Rat 17beta-estradiol decreases expression ISO RIMS3 (Homo sapiens) 6480464 Estradiol results in decreased expression of RIMS3 mRNA CTD PMID:31614463 Rims3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rims3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to RIMS3 promoter] CTD PMID:19654925 Rims3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RIMS3 mRNA CTD PMID:32109520 Rims3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rims3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RIMS3 mRNA CTD PMID:28922406 Rims3 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Rims3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO RIMS3 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Rims3 Rat 2-methylcholine affects expression ISO RIMS3 (Homo sapiens) 6480464 beta-methylcholine affects the expression of RIMS3 mRNA CTD PMID:21179406 Rims3 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Rims3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of RIMS3 mRNA CTD PMID:20188158 Rims3 Rat 4,4'-sulfonyldiphenol decreases expression ISO Rims3 (Mus musculus) 6480464 bisphenol S results in decreased expression of RIMS3 mRNA CTD PMID:39298647 Rims3 Rat 4,4'-sulfonyldiphenol increases methylation ISO RIMS3 (Homo sapiens) 6480464 bisphenol S results in increased methylation of RIMS3 gene CTD PMID:31601247 Rims3 Rat 5-aza-2'-deoxycytidine affects expression ISO RIMS3 (Homo sapiens) 6480464 Decitabine affects the expression of RIMS3 mRNA CTD PMID:23300844 Rims3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of RIMS3 mRNA CTD PMID:25825206 Rims3 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of RIMS3 mRNA CTD PMID:28959563 Rims3 Rat Aflatoxin B2 alpha increases methylation ISO RIMS3 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of RIMS3 intron CTD PMID:30157460 Rims3 Rat all-trans-retinoic acid decreases expression ISO RIMS3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of RIMS3 mRNA CTD PMID:21934132 and PMID:23724009 Rims3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RIMS3 mRNA CTD PMID:16483693 Rims3 Rat aristolochic acid A decreases expression ISO RIMS3 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of RIMS3 mRNA CTD PMID:33212167 Rims3 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of RIMS3 gene CTD PMID:35440735 Rims3 Rat benzene affects expression EXP 6480464 Benzene affects the expression of RIMS3 mRNA CTD PMID:15878777 Rims3 Rat benzo[a]pyrene multiple interactions ISO Rims3 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to RIMS3 promoter] CTD PMID:19654925 Rims3 Rat benzo[a]pyrene affects methylation ISO RIMS3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of RIMS3 5' UTR and Benzo(a)pyrene affects the methylation of RIMS3 intron CTD PMID:27901495 and PMID:30157460 Rims3 Rat benzo[a]pyrene decreases expression ISO RIMS3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of RIMS3 mRNA CTD PMID:26238291 Rims3 Rat benzo[e]pyrene increases methylation ISO RIMS3 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of RIMS3 intron CTD PMID:30157460 Rims3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RIMS3 mRNA CTD PMID:25181051 Rims3 Rat bisphenol A increases expression ISO RIMS3 (Homo sapiens) 6480464 bisphenol A results in increased expression of RIMS3 mRNA CTD PMID:33670352 and PMID:36232920 Rims3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of RIMS3 gene CTD PMID:28505145 Rims3 Rat butanal increases expression ISO RIMS3 (Homo sapiens) 6480464 butyraldehyde results in increased expression of RIMS3 mRNA CTD PMID:26079696 Rims3 Rat carbon nanotube increases expression ISO Rims3 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of RIMS3 mRNA CTD PMID:25554681 Rims3 Rat carbon nanotube decreases expression ISO Rims3 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of RIMS3 mRNA CTD PMID:25554681 Rims3 Rat CGP 52608 multiple interactions ISO RIMS3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to RIMS3 gene] CTD PMID:28238834 Rims3 Rat chlordecone increases expression ISO Rims3 (Mus musculus) 6480464 Chlordecone results in increased expression of RIMS3 mRNA CTD PMID:29980752 Rims3 Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of RIMS3 mRNA CTD PMID:18668222 Rims3 Rat cisplatin affects expression ISO RIMS3 (Homo sapiens) 6480464 Cisplatin affects the expression of RIMS3 mRNA CTD PMID:23300844 Rims3 Rat cisplatin multiple interactions ISO RIMS3 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of RIMS3 mRNA CTD PMID:27392435 Rims3 Rat copper(II) sulfate decreases expression ISO RIMS3 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of RIMS3 mRNA CTD PMID:19549813 Rims3 Rat dorsomorphin multiple interactions ISO RIMS3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Rims3 Rat doxorubicin decreases expression ISO RIMS3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of RIMS3 mRNA CTD PMID:29803840 Rims3 Rat entinostat increases expression ISO RIMS3 (Homo sapiens) 6480464 entinostat results in increased expression of RIMS3 mRNA CTD PMID:26272509 Rims3 Rat entinostat multiple interactions ISO RIMS3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of RIMS3 mRNA CTD PMID:27188386 Rims3 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of RIMS3 mRNA CTD PMID:18035473 Rims3 Rat genistein decreases expression ISO Rims3 (Mus musculus) 6480464 Genistein results in decreased expression of RIMS3 mRNA CTD PMID:32186404 Rims3 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of RIMS3 mRNA CTD PMID:24915197 Rims3 Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of RIMS3 gene CTD PMID:35440735 Rims3 Rat hydrogen peroxide affects expression ISO RIMS3 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of RIMS3 mRNA CTD PMID:20044591 and PMID:21179406 Rims3 Rat lipopolysaccharide decreases expression ISO RIMS3 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of RIMS3 mRNA CTD PMID:35811015 Rims3 Rat lipopolysaccharide multiple interactions ISO RIMS3 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of RIMS3 mRNA CTD PMID:35811015 Rims3 Rat maneb multiple interactions ISO Rims3 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of RIMS3 mRNA CTD PMID:36117858 Rims3 Rat methapyrilene increases methylation ISO RIMS3 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of RIMS3 intron CTD PMID:30157460 Rims3 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of RIMS3 gene CTD PMID:35440735 Rims3 Rat methylmercury chloride increases expression ISO RIMS3 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of RIMS3 mRNA CTD PMID:23179753 Rims3 Rat methylseleninic acid increases expression ISO RIMS3 (Homo sapiens) 6480464 methylselenic acid results in increased expression of RIMS3 mRNA CTD PMID:18548127 Rims3 Rat N-methyl-4-phenylpyridinium increases expression ISO RIMS3 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of RIMS3 mRNA CTD PMID:24810058 Rims3 Rat ozone multiple interactions ISO Rims3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of RIMS3 mRNA CTD PMID:34911549 Rims3 Rat paracetamol increases expression ISO RIMS3 (Homo sapiens) 6480464 Acetaminophen results in increased expression of RIMS3 mRNA CTD PMID:29067470 Rims3 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of RIMS3 mRNA CTD PMID:33387578 Rims3 Rat paraquat multiple interactions ISO Rims3 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of RIMS3 mRNA CTD PMID:36117858 Rims3 Rat pentanal increases expression ISO RIMS3 (Homo sapiens) 6480464 pentanal results in increased expression of RIMS3 mRNA CTD PMID:26079696 Rims3 Rat phenylmercury acetate decreases expression ISO RIMS3 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of RIMS3 mRNA CTD PMID:26272509 Rims3 Rat phenylmercury acetate multiple interactions ISO RIMS3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of RIMS3 mRNA CTD PMID:27188386 Rims3 Rat pirinixic acid multiple interactions ISO Rims3 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of RIMS3 mRNA CTD PMID:19710929 Rims3 Rat propanal increases expression ISO RIMS3 (Homo sapiens) 6480464 propionaldehyde results in increased expression of RIMS3 mRNA CTD PMID:26079696 Rims3 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RIMS3 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of RIMS3 mRNA CTD PMID:35811015 Rims3 Rat SB 431542 multiple interactions ISO RIMS3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Rims3 Rat serpentine asbestos increases expression ISO RIMS3 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of RIMS3 mRNA CTD PMID:21148743 Rims3 Rat silicon dioxide decreases expression ISO RIMS3 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of RIMS3 mRNA CTD PMID:25895662 Rims3 Rat silicon dioxide increases expression ISO RIMS3 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of RIMS3 mRNA CTD PMID:25351596 Rims3 Rat sodium arsenite increases expression ISO RIMS3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of RIMS3 mRNA CTD PMID:38568856 Rims3 Rat sunitinib increases expression ISO RIMS3 (Homo sapiens) 6480464 Sunitinib results in increased expression of RIMS3 mRNA CTD PMID:31533062 Rims3 Rat temozolomide decreases expression ISO RIMS3 (Homo sapiens) 6480464 Temozolomide results in decreased expression of RIMS3 mRNA CTD PMID:31758290 Rims3 Rat thapsigargin increases expression ISO RIMS3 (Homo sapiens) 6480464 Thapsigargin results in increased expression of RIMS3 mRNA CTD PMID:22378314 Rims3 Rat thiram increases expression ISO RIMS3 (Homo sapiens) 6480464 Thiram results in increased expression of RIMS3 mRNA CTD PMID:38568856 Rims3 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of RIMS3 gene CTD PMID:27618143 Rims3 Rat trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of RIMS3 mRNA CTD PMID:23558232 Rims3 Rat trichostatin A increases expression ISO RIMS3 (Homo sapiens) 6480464 trichostatin A results in increased expression of RIMS3 mRNA CTD PMID:28542535 Rims3 Rat triphenyl phosphate affects expression ISO RIMS3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RIMS3 mRNA CTD PMID:37042841 Rims3 Rat tunicamycin increases expression ISO RIMS3 (Homo sapiens) 6480464 Tunicamycin results in increased expression of RIMS3 mRNA CTD PMID:22378314 and PMID:29453283 Rims3 Rat urethane decreases expression ISO RIMS3 (Homo sapiens) 6480464 Urethane results in decreased expression of RIMS3 mRNA CTD PMID:28818685 Rims3 Rat valproic acid affects expression ISO Rims3 (Mus musculus) 6480464 Valproic Acid affects the expression of RIMS3 mRNA CTD PMID:17292431 Rims3 Rat valproic acid increases expression ISO RIMS3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of RIMS3 mRNA CTD PMID:22083351 more ... Rims3 Rat valproic acid affects expression ISO RIMS3 (Homo sapiens) 6480464 Valproic Acid affects the expression of RIMS3 mRNA CTD PMID:25979313 Rims3 Rat vanadyl sulfate decreases expression ISO RIMS3 (Homo sapiens) 6480464 vanadyl sulfate results in decreased expression of RIMS3 mRNA CTD PMID:16330358 Rims3 Rat zoledronic acid decreases expression ISO RIMS3 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of RIMS3 mRNA CTD PMID:24714768
1,2-dichloroethane (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) atrazine (EXP) benzene (EXP) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) butanal (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) chlorpyrifos (EXP) cisplatin (ISO) copper(II) sulfate (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) flavonoids (EXP) genistein (ISO) glycidol (EXP) glyphosate (EXP) hydrogen peroxide (ISO) lipopolysaccharide (ISO) maneb (ISO) methapyrilene (ISO) methoxychlor (EXP) methylmercury chloride (ISO) methylseleninic acid (ISO) N-methyl-4-phenylpyridinium (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (ISO) pentanal (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) propanal (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sunitinib (ISO) temozolomide (ISO) thapsigargin (ISO) thiram (ISO) trichloroethene (EXP) trichostatin A (EXP,ISO) triphenyl phosphate (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vanadyl sulfate (ISO) zoledronic acid (ISO)
1.
RIM3¿ and RIM4¿ are key regulators of neuronal arborization.
Alvarez-Baron E, etal., J Neurosci. 2013 Jan 9;33(2):824-39. doi: 10.1523/JNEUROSCI.2229-12.2013.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
RIM3gamma is a postsynaptic protein in the rat central nervous system.
Liang F, etal., J Comp Neurol. 2007 Aug 1;503(4):501-10. doi: 10.1002/cne.21403.
4.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.
GOA pipeline
RGD automated data pipeline
6.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
7.
Rab3-interacting molecule gamma isoforms lacking the Rab3-binding domain induce long lasting currents but block neurotransmitter vesicle anchoring in voltage-dependent P/Q-type Ca2+ channels.
Uriu Y, etal., J Biol Chem. 2010 Jul 9;285(28):21750-67. doi: 10.1074/jbc.M110.101311. Epub 2010 May 7.
8.
The RIM/NIM family of neuronal C2 domain proteins. Interactions with Rab3 and a new class of Src homology 3 domain proteins.
Wang Y, etal., J Biol Chem 2000 Jun 30;275(26):20033-44.
Rims3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 139,714,302 - 139,754,145 (+) NCBI GRCr8 mRatBN7.2 5 134,429,092 - 134,468,935 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 134,435,829 - 134,640,489 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 137,156,405 - 137,196,267 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 138,912,890 - 138,952,753 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 138,933,480 - 138,973,342 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 139,790,395 - 139,819,014 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 139,783,951 - 139,819,016 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 143,583,599 - 143,612,218 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 141,449,059 - 141,477,301 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 141,454,284 - 141,482,527 (+) NCBI Celera 5 132,990,363 - 133,018,593 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
RIMS3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 40,620,680 - 40,692,066 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 40,620,680 - 40,665,682 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 41,086,352 - 41,131,354 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 40,858,939 - 40,903,915 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 40,755,444 - 40,800,417 NCBI Celera 1 39,368,745 - 39,413,732 (-) NCBI Celera Cytogenetic Map 1 p34.2 NCBI HuRef 1 39,204,205 - 39,249,067 (-) NCBI HuRef CHM1_1 1 41,202,239 - 41,247,200 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 40,489,861 - 40,544,972 (-) NCBI T2T-CHM13v2.0
Rims3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 120,711,976 - 120,753,777 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 120,712,013 - 120,753,776 (+) Ensembl GRCm39 Ensembl GRCm38 4 120,854,779 - 120,896,580 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 120,854,816 - 120,896,579 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 120,550,474 - 120,564,165 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 120,375,504 - 120,389,195 (+) NCBI MGSCv36 mm8 Celera 4 119,596,297 - 119,610,071 (+) NCBI Celera Cytogenetic Map 4 D2.1 NCBI cM Map 4 56.58 NCBI
Rims3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955537 489,392 - 522,299 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955537 483,717 - 522,053 (-) NCBI ChiLan1.0 ChiLan1.0
RIMS3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 186,153,304 - 186,224,862 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 185,294,568 - 185,366,114 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 39,886,961 - 39,958,519 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 41,233,860 - 41,278,282 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 41,239,798 - 41,278,282 (-) Ensembl panpan1.1 panPan2
RIMS3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 2,353,876 - 2,391,742 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 2,353,693 - 2,404,431 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 2,612,164 - 2,653,723 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 2,442,973 - 2,484,475 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 2,442,760 - 2,493,363 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 2,348,666 - 2,390,205 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 2,408,787 - 2,450,270 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 2,424,598 - 2,466,154 (+) NCBI UU_Cfam_GSD_1.0
Rims3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 56,487,166 - 56,528,251 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 22,317,461 - 22,353,082 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 22,311,946 - 22,353,017 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RIMS3
RIMS3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 92,255,143 - 92,302,108 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 92,255,195 - 92,296,239 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 24,578,764 - 24,625,743 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rims3
.
Predicted Target Of
Count of predictions: 75 Count of miRNA genes: 61 Interacting mature miRNAs: 70 Transcripts: ENSRNOT00000015033 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 7365049 Bp359 Blood pressure QTL 359 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128071929 134724733 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
D5Rat169
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 139,724,563 - 139,724,757 (+) Marker Load Pipeline mRatBN7.2 5 134,439,349 - 134,439,543 (+) MAPPER mRatBN7.2 Rnor_6.0 5 139,793,916 - 139,794,109 NCBI Rnor6.0 Rnor_5.0 5 143,587,120 - 143,587,313 UniSTS Rnor5.0 RGSC_v3.4 5 141,452,579 - 141,452,773 RGD RGSC3.4 RGSC_v3.4 5 141,452,580 - 141,452,773 UniSTS RGSC3.4 RGSC_v3.1 5 141,457,806 - 141,457,999 RGD Celera 5 132,993,884 - 132,994,077 UniSTS RH 3.4 Map 5 875.2 UniSTS RH 3.4 Map 5 875.2 RGD RH 2.0 Map 5 870.0 RGD SHRSP x BN Map 5 71.7699 RGD Cytogenetic Map 5 q36 UniSTS
RH130458
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 134,448,863 - 134,449,080 (+) MAPPER mRatBN7.2 Rnor_6.0 5 139,803,606 - 139,803,822 NCBI Rnor6.0 Rnor_5.0 5 143,596,810 - 143,597,026 UniSTS Rnor5.0 RGSC_v3.4 5 141,462,094 - 141,462,310 UniSTS RGSC3.4 Celera 5 133,003,398 - 133,003,614 UniSTS RH 3.4 Map 5 875.5 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
4
31
113
66
62
36
17
36
6
143
65
93
29
59
26
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015033 ⟹ ENSRNOP00000015034
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 134,435,829 - 134,640,489 (+) Ensembl Rnor_6.0 Ensembl 5 139,790,395 - 139,819,016 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000081333 ⟹ ENSRNOP00000074454
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 139,783,951 - 139,819,016 (+) Ensembl
RefSeq Acc Id:
NM_022931 ⟹ NP_075220
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 139,714,320 - 139,754,145 (+) NCBI mRatBN7.2 5 134,429,106 - 134,468,933 (+) NCBI Rnor_6.0 5 139,790,395 - 139,819,014 (+) NCBI Rnor_5.0 5 143,583,599 - 143,612,218 (+) NCBI RGSC_v3.4 5 141,449,059 - 141,477,301 (+) RGD Celera 5 132,990,363 - 133,018,593 (+) RGD
Sequence:
CCTGTCCTCTCTGACTGGATTCGTTATCATGACCCTGGATTCTGGCCATACTCAAGAATTAGCACCTCGGGCTTGGCAGATATAAGTCCAAATTCCCAGGAGAAGATCTGATTGGCTCTGAGGGACTT
hide sequence
RefSeq Acc Id:
XM_039110727 ⟹ XP_038966655
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 139,714,302 - 139,754,142 (+) NCBI mRatBN7.2 5 134,429,092 - 134,468,935 (+) NCBI
RefSeq Acc Id:
NP_075220 ⟸ NM_022931
- UniProtKB:
Q9JIR3 (UniProtKB/Swiss-Prot), G3V7H4 (UniProtKB/TrEMBL), A6IRZ7 (UniProtKB/TrEMBL)
- Sequence:
MFNGEPGPASAGASRNVVRSSSISGEICGSQQAGGGAGTTTAKKRRSSLGAKMVAIVGLTQWSKSTLQLPQPEGATKKLRSNIRRSTETGIAVEMRSRVTRQGSRESTDGSTNSNSSEGTFIFPTRLG
hide sequence
Ensembl Acc Id:
ENSRNOP00000074454 ⟸ ENSRNOT00000081333
Ensembl Acc Id:
ENSRNOP00000015034 ⟸ ENSRNOT00000015033
RefSeq Acc Id:
XP_038966655 ⟸ XM_039110727
- Peptide Label:
isoform X1
BioCyc Gene G2FUF-40050 BioCyc
Ensembl Genes ENSRNOG00000011171 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000015033.3 UniProtKB/TrEMBL
ENSRNOT00000120626 ENTREZGENE
Gene3D-CATH 2.60.40.150 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro C2_dom UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
C2_domain_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Rim-like UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:65025 UniProtKB/Swiss-Prot
NCBI Gene 65025 ENTREZGENE
PANTHER PTHR12157 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
REGULATING SYNAPTIC MEMBRANE EXOCYTOSIS PROTEIN 3 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam PF00168 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Rims3 PhenoGen
PROSITE PS50004 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000011171 RatGTEx
SMART SM00239 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP SSF49562 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A6IRZ7 ENTREZGENE, UniProtKB/TrEMBL
G3V7H4 ENTREZGENE, UniProtKB/TrEMBL
Q9JIR3 ENTREZGENE, UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Rims3
regulating synaptic membrane exocytosis 3
nim3 protein
Name updated
1299863 APPROVED
2004-09-10
Rims3
nim3 protein
Nim3
Symbol and Name updated
1299863 APPROVED
2003-04-09
Nim3
nim3 protein
Symbol and Name updated
629477 APPROVED
2003-03-06
Nim3
nim3 protein
Nim2
Nim2
Data merged from RGD:620947
628472 PROVISIONAL
2003-02-27
Nim3
Nim3
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-08-07
Nim2
Nim2
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_product
member of the RIM/NIM family of C2 domain proteins
633421
gene_transcript
encoded by the 3'end of RIM2, contains a unique N-terminal region with the C-terminal region of RIM2
633421
